Print…

You Searched For: western+blotting+equipment


155,732  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"155732"

Rate These Search Results

Image Unavailable-102190-996

MSH5 Antibody

Catalog Number: 102190-996
Supplier: Novus Biologicals
Image Unavailable-10800-390

Blocking Buffer Sampler kit

Description: Blocking Buffer Sampler Kit, contains: NORMAL GOAT SERUM (NGS), Bovine serum Albumin - Fraction V (Immunoglobulin and Protease Free), Blocking Buffer (2X), ELISA Microwell Blocking Buffer with Stabilizer (Azide and Mercury Free), 4 deg C. Application: ELISA, WB, IHC
Catalog Number: 10800-390
Supplier: Rockland Immunochemical
Image Unavailable-103278-286

C2orf76 Polyclonal Antibody 100UL

Description: C2orf76, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDVPLRTNLPPPFRNYKYD, Synonyms: AIM29, chromosome 2 open reading frame 76, Application: Western Blot, IHC, IHC-P, Size: 100UL
Catalog Number: 103278-286
Supplier: Novus Biologicals
Product Image-RL610-445-041

Secondary Antibody DyLight* 800 Conjugated Affinity Purified Anti-MOUSE IgG2a (Gamma 2a chain) (RABBIT)

Description: Is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting.100ug
Catalog Number: RL610-445-041
Supplier: Rockland Immunochemical
Product Image-RL610-441-043

Secondary Antibody DyLight* 488 Conjugated Affinity Purified Anti-MOUSE IgG3 (Gamma 3 chain) (RABBIT)

Description: Is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting.100ug
Catalog Number: RL610-441-043
Supplier: Rockland Immunochemical
Product Image-RL610-443-043

Secondary Antibody DyLight* 649 Conjugated Affinity Purified Anti-MOUSE IgG3 (Gamma 3 chain) (RABBIT)

Description: Is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting.100ug
Catalog Number: RL610-443-043
Supplier: Rockland Immunochemical
Product Image-RL610-444-040

Secondary Antibody DyLight* 680 Conjugated Affinity Purified Anti-MOUSE IgG1 (Gamma 1 chain) (RABBIT)

Description: Is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting.100ug
Catalog Number: RL610-444-040
Supplier: Rockland Immunochemical
Product Image-RL610-442-040

Secondary Antibody DyLight* 549 Conjugated Affinity Purified Anti-MOUSE IgG1 (Gamma 1 chain) (RABBIT)

Description: Is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting.100ug
Catalog Number: RL610-442-040
Supplier: Rockland Immunochemical
Image Unavailable-82022-296

Human, Tumor Tissue, Human Testis GenLysate™

Description: Human, Tumor Tissue, Human Testis GenLysate™
Catalog Number: 82022-296
Supplier: G-Biosciences
Image Unavailable-103324-806

CYP4B1 Polyclonal antibody 0.05 mg

Description: CYP4B1, Polyclonal antibody, Host: Mouse, Species reactivity: Human, Conjugate: Unconjugated, Immunogen: CYP4B1 (AAH17758.1, 1 a.a. - 512 a.a.) full-length human protein, Synonyms: CYPIVB1, cytochrome P450 4B1, Application: Western blot, Size: 0.05 mg
Catalog Number: 103324-806
Supplier: Novus Biologicals
Image Unavailable-103324-814

CYP11B1 Polyclonal antibody 0.1 mg

Description: CYP11B1, Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Immunogen: CYP11B1 (AAH96285.1, 1 a.a. - 574 a.a.) full-length human protein, Synonyms: CPN1, CYPXIB1, cytochrome P450 11B1, mitochondrial, Application: Western blot, Size: 0.1 mg
Catalog Number: 103324-814
Supplier: Novus Biologicals
Image Unavailable-103325-056

Cochlin Polyclonal antibody 0.05 mg

Description: Cochlin, Polyclonal antibody, Host: Mouse, Species reactivity: Human, Immunogen: COCH (AAH07230.1, 1 a.a. - 494 a.a.) full-length human protein, Synonyms: coagulation factor C (Limulus polyphemus homolog); cochlin, Application: Western blot, Size: 0.05 mg
Catalog Number: 103325-056
Supplier: Novus Biologicals
Image Unavailable-103325-376

DUSP7 Polyclonal antibody 0.1 mg

Description: DUSP7, Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Conjugate: Unconjugated, Immunogen: DUSP7 (AAH19107.1, 1 a.a. - 320 a.a.) full-length human protein, Synonyms: DKFZp586F2224, Application: Western blot, Purity: Protein G purified, Size: 0.1 mg
Catalog Number: 103325-376
Supplier: Novus Biologicals
Image Unavailable-103324-832

DAB1 Polyclonal antibody 0.05 mg

Description: DAB1, Polyclonal antibody, Host: Mouse, Species reactivity: Human, Immunogen: DAB1 (AAH67445.1, 1 a.a. - 553 a.a.) full-length human protein, Synonyms: disabled (Drosophila) homolog 1, disabled homolog 1 (Drosophila), Application: Western blot, Size: 0.05 mg
Catalog Number: 103324-832
Supplier: Novus Biologicals
Image Unavailable-103331-544

NDUFB10 Polyclonal antibody 0.05 mg

Description: NDUFB10 Polyclonal antibody, Host: Mouse, Reactivity: Human, Unconjugated, Immunogen: NDUFB10 (NP-004539.1, 1 a.a. - 172 a.a.) full-length human protein, Synonyms: CI-PDSW, store at -20C or -80C, Applications: Western blot, Size: 0.05 mg
Catalog Number: 103331-544
Supplier: Novus Biologicals
Image Unavailable-103310-814

SSX1 Polyclonal Antibody 0.05 mg

Description: SSX1, Polyclonal Antibody, Host: Mouse, Species reactivity: human, Immunogen: SSX1 full-length human protein, Synonyms: Cancer/testis antigen 5.1, Application: Western Blot, Purity: Protein G purified, Storage: -20C or -80C, Size: 0.05 mg
Catalog Number: 103310-814
Supplier: Novus Biologicals
3,681 - 3,696 of 155,732