Print…

You Searched For: viral+rna


17,122  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"17122"

Rate These Search Results

Image Unavailable-103010-404

West Nile Virus NS3 Protease recombinant 5 ug

Description: West Nile Virus NS3 Protease, recombinant, Concentration: 100 ug/ml, is a member of the flavivirus genus, which contains many significant human pathogens including Dengue virus, positive sense 11kb RNA genome, Storage: -80 deg C, size: 5 ug
Catalog Number: 103010-404
Supplier: Anaspec Inc
Image Unavailable-76082-304

PKR THR451 PAB 100ul

Description: PKR THR451 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Conjugate: Alexa Fluor 680, Immunogen: KLH conjugated synthetic peptide derived from PKR THR451, Synonyms: Interferon-induced, double-stranded RNA-activated
Catalog Number: 76082-304
Supplier: Bioss
Product Image-89416-002

DDX3 0.1MG

Description: Polyclonal Antibody An RNA helicase that may be involved in HIV-1 nuclear export, Host: Rabbit, Immunogen: DDX3 Antibody was raised against a 16 amino acid synthetic peptide from near the amino terminus of human DDX3, Species reactivity: human,mouse,Rat, Isotype: IgG
Catalog Number: 89416-002
Supplier: Prosci
Image Unavailable-10767-078

Label It* Nuc Mod Amine 100ug

Description: Label It* Nuc Mod Amine, covalently attached to nucleic acids (DNA or RNA) within minutes. This chemical labeling reaction allows one to directly control the level of nucleic acid modification without impacting function or hybridization performance, Size: 100ug
Catalog Number: 10767-078
Supplier: Mirus Bio

SDS


Image Unavailable-10767-080

Label It* Nuc Mod Amine 25ug

Description: Label It* Nuc Mod Amine, covalently attached to nucleic acids (DNA or RNA) within minutes. This chemical labeling reaction allows one to directly control the level of nucleic acid modification without impacting function or hybridization performance, Size: 25ug
Catalog Number: 10767-080
Supplier: Mirus Bio

SDS


Product Image-PAZ5210

PolyATtract mRNA Isolation System I (Refill for Z5200), 3 isolations

Description: Store at 4[degree]C. Do not freeze the MagneSphere Paramagnetic Particles.
Catalog Number: PAZ5210
Supplier: Promega Corporation

Certificates


Product Image-103258-290

In vivo SilenceMag* Transfection Reagent 500 uL

Description: In vivo SilenceMag* Transfection Reagent, is a rapid, simple and highly efficient method dedicated to transfect small RNA (siRNA, miRNA) into target cells/tissue in vivo, Penetration of the siRNA/miRNA into tissues, Minimized toxicity, Size: 500ul
Catalog Number: 103258-290
Supplier: OZ Biosciences
Product Image-103258-292

In vivo SilenceMag* Transfection Reagent 1 mL

Description: In vivo SilenceMag* Transfection Reagent, is a rapid, simple and highly efficient method dedicated to transfect small RNA (siRNA, miRNA) into target cells/tissue in vivo, Penetration of the siRNA/miRNA into tissues, Minimized toxicity, Size: 1ml
Catalog Number: 103258-292
Supplier: OZ Biosciences
Product Image-PAZ5200

PolyATtract mRNA Isolation System II with Magnetic Stand, 3 isolations

Description: Store at 4[degree]C. Do not freeze the MagneSphere Paramagnetic Particles.
Catalog Number: PAZ5200
Supplier: Promega Corporation

Certificates


Image Unavailable-10308-998

E2AK2/PKR Antibody

Description: E2AK2/PKR Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Interferon-induced, double-stranded RNA-activated protein kinase, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10308-998
Supplier: Bioss
Product Image-10085-482

Anti-CYCLIN T1

Description: Anti-CYCLIN T1 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Peptide, Peptide with Sequence CKTRVPHSKLDKGPTGANGH, Format:Antigen affinity purification, Application: ELISA, WB, Recommended Storage: - 20 C or lower
Catalog Number: 10085-482
Supplier: Proteintech
Image Unavailable-10308-990

E2AK2/PKR Antibody

Description: E2AK2/PKR Polyclonal Antibody, Host: Rabbit, Cy3 Conjugated, Emmission: 512, 550nm/570, 615nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Interferon-induced, double-stranded RNA-activated protein kinase, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10308-990
Supplier: Bioss
Product Image-76011-552

MED6 PAB 400uL

Description: MED6, Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: Ig, Immunogen: synthetic peptide between 217-246 a.a from the C-terminal, Synonyms: Mediator of RNA polymerase II transcription subunit 6, Activator-recruited cofactor 33 kDa component, Application: WB, Size: 400uL
Catalog Number: 76011-552
Supplier: Prosci
Image Unavailable-89278-866

MS MAB to AKT3

Description: Mouse Monoclonal antibody to AKT3 (v-akt murine thymoma viral oncogene homolog 3 (protein kinase B gamma)) Clone: 66C1247.1 Purity: Protein G purified Species Reactivity: Human Mouse Rat Tested Applications: WB Pkg Size: 100 ug
Catalog Number: 89278-866
Supplier: Genetex
Image Unavailable-76174-026

EWSR1 Picoband* Polyclonal Antibody 100ug/vial

Description: EWSR1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH, Synonyms: RNA-binding protein EWS, EWS oncogene, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-026
Supplier: Boster Biological Technology
Image Unavailable-76171-150

DDX3 Picoband polyclonal Antibody 100ug

Description: DDX3 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DDX3 (2-28aa), Synonym: ATP-dependent RNA helicase DDX3X, Application: WB, Size:100ug
Catalog Number: 76171-150
Supplier: Boster Biological Technology
1,505 - 1,520 of 17,122