Print…

You Searched For: viral+rna


17,122  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"17122"

Rate These Search Results

Image Unavailable-10478-362

GTF2B Antibody

Description: GTF2B Polyclonal Antibody, Host: Rabbit , Cy3 Conjugated, Emmission: 512,550nm/570,615nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: TFIIB; General transcription factor IIB; General transcription factor TFIIB; GTF2B; RNA polymerase II transcription factor IIB, 100ul
Catalog Number: 10478-362
Supplier: Bioss
Product Image-76011-922

POLR2G Polyclonal antibody 400uL

Description: POLR2G, Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: Ig, Immunogen: synthetic peptide between 126-153 amino acids from the C-terminal, Synonyms: DNA-directed RNA polymerase II subunit RPB7, Application: WB, Storage: 4 deg C, Size: 400uL
Catalog Number: 76011-922
Supplier: Prosci
Image Unavailable-76174-630

Staufen Picoband* Polyclonal Antibody 100ug/vial

Description: Staufen Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 532-568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN, Synonyms: Double-stranded RNA-binding protein Staufen homolog 1, STAU1, STAU, Size: 100ug/vial
Catalog Number: 76174-630
Supplier: Boster Biological Technology
Product Image-76423-480

Kit

Description: Virus/Pathogen Kit, For total nucleic acid (DNA/RNA) isolation from bacteria/viruses including COVID-1, Contents: Binding/Lysis Reagent 60mL; Wash Buffer 100mL; SeraSil-Mag 400 beads 1.1mL; SeraSil-Mag 700 beads 1.1mL; Proteinase K 30mg (lyophilized), Size: 1000purifications
Catalog Number: 76423-480
Supplier: GE Healthcare - Life Sciences

SDS


Image Unavailable-77060-330

ANTIBODY ANTI-RCL1 A97944-100 100UG

Catalog Number: 77060-330
Supplier: ANTIBODIES.COM LLC
Image Unavailable-10478-366

GTF2B Antibody

Description: GTF2B Polyclonal Antibody, Host: Rabbit , Cy5.5 Conjugated, Emmission: 675nm/694nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: TFIIB; General transcription factor IIB; General transcription factor TFIIB; GTF2B; RNA polymerase II transcription factor IIB, 100ul
Catalog Number: 10478-366
Supplier: Bioss
Product Image-76326-030

Single Cell Lysis Module Nebnext 96 Rxns

Description: NEBNext* Single Cell Lysis Module, for lysis and storage of cells, optimized for use with the NEBNext Single Cell/Low Input RNA Library Prep Kit for Illumina, 96 reactions
Catalog Number: 76326-030
Supplier: New England Biolabs (NEB)
Image Unavailable-76108-136

GTF2B PAB 100ul

Description: GTF2B Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species: Human, Mouse, Rat, Conjugate: Alexa Fluor 750, Synonyms: TFIIB, General transcription factor IIB, General transcription factor TFIIB, GTF2B, RNA polymerase II transcription factor IIB, Application: IHC-P, Size: 100ul
Catalog Number: 76108-136
Supplier: Bioss
Image Unavailable-89319-368

Rabbit Polyclonal antibody to TAF7

Description: TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89319-368
Supplier: Genetex
Image Unavailable-89319-620

Rabbit Polyclonal antibody to TAF172

Description: BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1 homolog, S. cerevisiae) Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89319-620
Supplier: Genetex
Image Unavailable-10309-000

E2AK2/PKR Antibody

Description: E2AK2/PKR Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Interferon-induced, double-stranded RNA-activated protein kinase, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10309-000
Supplier: Bioss
Image Unavailable-103223-344

MIP-I Polyclonal Antibody 100UG

Description: MIP-I, Polyclonal Antibody, Host: Goat, Species reactivity: Viral, Isotype: IgG, Immunogen: E. Coli-derived recombinant human herpes virus-8 MIP-I Ala25-Ala95, Application: WB, Neut, storage: -20 to -70 deg C, Size: 100UG
Catalog Number: 103223-344
Supplier: Novus Biologicals
Image Unavailable-103335-364

DDX3Y PAB 0.1mg, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: DDX3Y (NP-004651.2, 1 a.a. - 660 a.a.) full-length human protein, Synonym: ATP-dependent RNA helicase DDX3Y

Description: DDX3Y PAB 0.1mg, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: DDX3Y (NP-004651.2, 1 a.a. - 660 a.a.) full-length human protein, Synonym: ATP-dependent RNA helicase DDX3Y
Catalog Number: 103335-364
Supplier: Novus Biologicals
Image Unavailable-10285-822

DHX15 Antibody

Description: DHX15 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: ATP dependent RNA helicase , Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10285-822
Supplier: Bioss
Image Unavailable-89424-232

Rabbit Polyclonal Antibody to RALY

Description: Rabbit Polyclonal Antibody to RALY (RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse))), Host: Rabbit, Isotype: IgG, Immunogen: Recombinant fragment amino acids 1 and 218, Species reactivity: Human, Mouse, 100ul.
Catalog Number: 89424-232
Supplier: Genetex
Image Unavailable-76082-304

PKR THR451 PAB 100ul

Description: PKR THR451 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Conjugate: Alexa Fluor 680, Immunogen: KLH conjugated synthetic peptide derived from PKR THR451, Synonyms: Interferon-induced, double-stranded RNA-activated
Catalog Number: 76082-304
Supplier: Bioss
1,473 - 1,488 of 17,122