Print…

You Searched For: viral+rna


17,122  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"17122"

Rate These Search Results

Image Unavailable-10478-370

GTF2B Antibody

Description: GTF2B Polyclonal Antibody, Host: Rabbit , FITC Conjugated, Emmission: 494nm/518nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: TFIIB; General transcription factor IIB; General transcription factor TFIIB; GTF2B; RNA polymerase II transcription factor IIB, 100ul
Catalog Number: 10478-370
Supplier: Bioss
Product Image-89320-496

Rabbit Polyclonal antibody to Parafibromin

Description: Cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89320-496
Supplier: Genetex
Image Unavailable-10309-000

E2AK2/PKR Antibody

Description: E2AK2/PKR Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Interferon-induced, double-stranded RNA-activated protein kinase, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10309-000
Supplier: Bioss
Image Unavailable-10478-362

GTF2B Antibody

Description: GTF2B Polyclonal Antibody, Host: Rabbit , Cy3 Conjugated, Emmission: 512,550nm/570,615nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: TFIIB; General transcription factor IIB; General transcription factor TFIIB; GTF2B; RNA polymerase II transcription factor IIB, 100ul
Catalog Number: 10478-362
Supplier: Bioss
Image Unavailable-76174-630

Staufen Picoband* Polyclonal Antibody 100ug/vial

Description: Staufen Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 532-568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN, Synonyms: Double-stranded RNA-binding protein Staufen homolog 1, STAU1, STAU, Size: 100ug/vial
Catalog Number: 76174-630
Supplier: Boster Biological Technology
Image Unavailable-103223-344

MIP-I Polyclonal Antibody 100UG

Description: MIP-I, Polyclonal Antibody, Host: Goat, Species reactivity: Viral, Isotype: IgG, Immunogen: E. Coli-derived recombinant human herpes virus-8 MIP-I Ala25-Ala95, Application: WB, Neut, storage: -20 to -70 deg C, Size: 100UG
Catalog Number: 103223-344
Supplier: Novus Biologicals
Image Unavailable-77060-330

ANTIBODY ANTI-RCL1 A97944-100 100UG

Catalog Number: 77060-330
Supplier: ANTIBODIES.COM LLC
Image Unavailable-89424-232

Rabbit Polyclonal Antibody to RALY

Description: Rabbit Polyclonal Antibody to RALY (RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse))), Host: Rabbit, Isotype: IgG, Immunogen: Recombinant fragment amino acids 1 and 218, Species reactivity: Human, Mouse, 100ul.
Catalog Number: 89424-232
Supplier: Genetex
Image Unavailable-EM71746-4

D-Tube Dialyzer Mega 20Ml MWCO

Description: The D-Tube Dialyzers be used for dialysis and electroelution of proteins, RNA, DNA, and oligonucleotides from polyacrylamide or agarose gels. Storage +15Degree Celsius to +30Degree Celsius.
Catalog Number: EM71746-4
Supplier: MilliporeSigma

Certificates


Image Unavailable-EM71743-4

D-Tube Dialyzer Mega 15Ml MWCO

Description: The D-Tube Dialyzers be used for dialysis and electroelution of proteins, RNA, DNA, and oligonucleotides from polyacrylamide or agarose gels. Storage +15Degree Celsius to +30Degree Celsius.
Catalog Number: EM71743-4
Supplier: MilliporeSigma

Certificates


Image Unavailable-EM71745-4

D-Tube Dialyzer Mega 20Ml MWCO

Description: The D-Tube Dialyzers be used for dialysis and electroelution of proteins, RNA, DNA, and oligonucleotides from polyacrylamide or agarose gels. Storage +15Degree Celsius to +30Degree Celsius.
Catalog Number: EM71745-4
Supplier: MilliporeSigma

Certificates


Image Unavailable-EM71746-3

D-Tube Dialyzer Mega 20Ml MWCO

Description: The D-Tube Dialyzers be used for dialysis and electroelution of proteins, RNA, DNA, and oligonucleotides from polyacrylamide or agarose gels. Storage +15Degree Celsius to +30Degree Celsius.
Catalog Number: EM71746-3
Supplier: MilliporeSigma

Certificates


Image Unavailable-EM71742-4

D-Tube Dialyzer Mega 15Ml MWCO

Description: The D-Tube Dialyzers be used for dialysis and electroelution of proteins, RNA, DNA, and oligonucleotides from polyacrylamide or agarose gels. Storage +15Degree Celsius to +30Degree Celsius.
Catalog Number: EM71742-4
Supplier: MilliporeSigma

Certificates


Image Unavailable-EM71745-3

D-Tube Dialyzer Mega 20Ml MWCO

Description: The D-Tube Dialyzers be used for dialysis and electroelution of proteins, RNA, DNA, and oligonucleotides from polyacrylamide or agarose gels. Storage +15Degree Celsius to +30Degree Celsius.
Catalog Number: EM71745-3
Supplier: MilliporeSigma

Certificates


Image Unavailable-EM71739-4

D-Tube Dialyzer Mega 10Ml MWCO

Description: The D-Tube Dialyzers be used for dialysis and electroelution of proteins, RNA, DNA, and oligonucleotides from polyacrylamide or agarose gels. Storage +15Degree Celsius to +30Degree Celsius.
Catalog Number: EM71739-4
Supplier: MilliporeSigma

Certificates


Image Unavailable-EM71742-3

D-Tube Dialyzer Mega 15Ml MWCO

Description: The D-Tube Dialyzers be used for dialysis and electroelution of proteins, RNA, DNA, and oligonucleotides from polyacrylamide or agarose gels. Storage +15Degree Celsius to +30Degree Celsius.
Catalog Number: EM71742-3
Supplier: MilliporeSigma

Certificates


1,473 - 1,488 of 17,122