You Searched For: viral+rna


16,715  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"16715"
Description: AIM2 Polyclonal Antibody, Host: Rabbit , Cy7 Conjugated, Emmission: 743nm/767nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: Gm1313; Ifi210; Aim2, Application: IF(IHC-P), 100ul
Catalog Number: 10427-906
Supplier: Bioss


Description: RASSF6 Polyclonal Antibody, Host: Rabbit , HRP Conjugated, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: RASF6_HUMAN, Application: IHC-P, 100ul
Catalog Number: 10427-300
Supplier: Bioss


Description: V-rel reticuloendotheliosis viral oncogene homolog A (avian) Clone: 112A1021 Purity: Protein G purified Species Reactivity: Human, Mouse, Cow, Gorilla, Monkey, Pig, Rat Tested Applications: FACS, IHC-P, WB Pkg Size: 100 ug
Catalog Number: 89359-772
Supplier: Genetex


Description: VPS4a Polyclonal Antibody, Host: Rabbit , Cy5 Conjugated, Emmission: 625,650nm/670nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: hVPS4; SKD1; SKD1 homolog; SKD2, Application: IF(IHC-P), 100ul
Catalog Number: 10469-504
Supplier: Bioss


Description: Conjugation: Agarose Purity: Immunogen affinity purified Tested Applications: IP Pkg Size: 100 ug
Catalog Number: 89351-618
Supplier: Genetex


Description: GCN5 Recombinant protein (His) (highly active), Source: Sf21 cells, Cross Reactivity: Human, Purity: greater than or equal to 95% (SDS-PAGE), Synonym: GCN5L2; Histone Acetyltransferase GCN5; Histone Acetyltransferase KAT2A; Lysine Acetyltransferase 2A; STAF97, Size: 2ug
Catalog Number: 102980-370
Supplier: Adipogen


Description: TRIM25 Polyclonal Antibody, Host: Rabbit , Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: EFP; Z147; RNF147; ZNF147, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10401-476
Supplier: Bioss


Description: Prostatic Acid Phosphatase (248-286), PAP (248-286), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4551.5, Sequence: GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY, Appearance: Powder, SEVI factor found in semen, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-214
Supplier: Anaspec Inc


Description: Rabbit Polyclonal antibody to NFkB-p65 (phospho Thr435) (v-rel reticuloendotheliosis viral oncogene homolog A (avian)) Purity: Affinity purified with antigen Species Reactivity: Human Mouse Rat Tested Applications: ICC/IF IHCWB Pkg Size: 100 ug
Catalog Number: 89276-584
Supplier: Genetex


Description: V-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) Clone: B978M Tested Applications: ELISA Pkg Size: 200 ug
Catalog Number: 89316-770
Supplier: Genetex


Description: Mouse Monoclonal antibody to LYN (v-yes-1 Yamaguchi sarcoma viral related oncogene homolog) Clone: 2H8D7 Species Reactivity: Human Tested Applications: ELISA Pkg Size: 100 ul
Catalog Number: 89284-286
Supplier: Genetex


Description: Anti-ANNEXIN A2(Monoclonal) Antibody, Host Species: Mouse, Cross Reactivity: Human, Mouse, Immunogen: Recombinant Protein, 1-339 amino acid, Format:Caprylic Acid/Ammonium Sulfate Precipitation, Application: ELISA, WB, IF, IHC, Recommended Storage: - 20 C or lower
Catalog Number: 10081-934
Supplier: Proteintech


Description: ATF3 Polyclonal Antibody, Host: Rabbit, Cy3 Conjugated, Emmission: 512, 550nm/570, 615nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: cAMP-dependent transcription factor ATF-3, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10242-594
Supplier: Bioss


Description: CREB-1 SER133 Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: CREB: CREB-1; CREB1, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10229-794
Supplier: Bioss


Description: Polyclonal antibody VEGFR2 (Ab 1214) Host: Rabbit Species reactivity: Human, Mouse, Rat Immunogen VEGFR2 (Ab-1214) antibody was raised against a peptide sequence around aa.1212 approx 1216 (F-H-Y-D-N) derived from Human VEGFR2.Tested application: IHC IF
Catalog Number: 10071-466
Supplier: Prosci


Catalog Number: 102513-118
Supplier: Adipogen

Small Business Enterprise


2,545 - 2,560 of 16,715