Print…

You Searched For: viral+rna


16,715  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"16715"

Rate These Search Results

Image Unavailable-89284-270

MS MAB to YES1

Description: Mouse Monoclonal antibody to YES1 (v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1) Clone: 2F3E6 Species Reactivity: Human Tested Applications: ELISA Pkg Size: 100 ul
Catalog Number: 89284-270
Supplier: Genetex
Image Unavailable-76083-070

TNFR1 PAB 100ul

Description: TNFR1 Polyclonal Antibody, Host: Rabbit, Species: Virus (HHV 8 type M), Isotype: IgG, Conjugate: Alexa Fluor 750, Immunogen: KLH conjugated synthetic peptide derived from TNFR1, Synonyms: Tumor necrosis factor receptor superfamily member
Catalog Number: 76083-070
Supplier: Bioss
Image Unavailable-76083-068

TNFR1 PAB 100ul

Description: TNFR1 Polyclonal Antibody, Host: Rabbit, Species: Virus (HHV 8 type M), Isotype: IgG, Conjugate: Alexa Fluor 680, Immunogen: KLH conjugated synthetic peptide derived from TNFR1, Synonyms: Tumor necrosis factor receptor superfamily member
Catalog Number: 76083-068
Supplier: Bioss
Image Unavailable-10343-902

CLEC5A Antibody

Description: CLEC5A Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Mdl1; Ly100; MDL-1; Clecsf5, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10343-902
Supplier: Bioss
Image Unavailable-10343-904

CLEC5A Antibody

Description: CLEC5A Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Mdl1; Ly100; MDL-1; Clecsf5, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10343-904
Supplier: Bioss
Image Unavailable-10348-792

TNFR1 Antibody

Description: TNFR1 Polyclonal Antibody, Host: Rabbit, Cy5 Conjugated, Emmission: 625, 650nm/670nm, Species: Virus (HHV 8 type M), Isotype: IgG, Synonymns: GAPD2; GAPDH 2; GAPDH 2; GAPDHS; GAPDS, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10348-792
Supplier: Bioss
Image Unavailable-103008-214

Prostatic Acid Phosphatase (248-286) 1mg

Description: Prostatic Acid Phosphatase (248-286), PAP (248-286), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4551.5, Sequence: GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY, Appearance: Powder, SEVI factor found in semen, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-214
Supplier: Anaspec Inc
Product Image-10071-072

EGFR Antibody

Description: Polyclonal antibody EGFR Host: Chicken Species reactivity: Human, Mouse, Rat immunogen: 1091-1210 Tested application: WB
Catalog Number: 10071-072
Supplier: Prosci
Image Unavailable-10765-296

Antibody

Description: IFN gamma Antibody, monoclonal, Host: Mouse, Species reactivity: Human, Isotype: IgG1, kappa, Clone: NIB42, Conjugate: PE, Applications: Fluorescence-activated cell sorting, Neut
Catalog Number: 10765-296
Supplier: Prosci
Image Unavailable-89304-644

RB PAB to MYC

Description: Rabbit Polyclonal antibody to Myc (v-myc myelocytomatosis viral oncogene homolog (avian)) Purity: Antibodies were purified by affinity-chromatography using epitope-specific peptide. Species Reactivity: Human Mouse Rat Tested Applications:IHC WB Pkg Size: 100 ul
Catalog Number: 89304-644
Supplier: Genetex
Product Image-10091-286

Anti-NRAS

Description: Anti-NRAS Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 1-189 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IF, IHC, Recommended Storage: - 20 C or lower
Catalog Number: 10091-286
Supplier: Proteintech
Image Unavailable-89284-254

MS MAB to SRC

Description: Mouse Monoclonal antibody to SRC (v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)) Clone: 4F1E8 Species Reactivity: Human Tested Applications: ELISA Pkg Size: 100 ul
Catalog Number: 89284-254
Supplier: Genetex
Image Unavailable-89287-516

MS MAB to ERBB3

Description: Mouse Monoclonal antibody to ERBB3 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)) Clone: 2B11D11 Species Reactivity: Human Tested Applications: ELISA Pkg Size: 100 ul
Catalog Number: 89287-516
Supplier: Genetex
Image Unavailable-89264-958

RB PAB to RAF-1 (S642)

Description: Rabbit Polyclonal antibody to Raf-1 (phospho Ser642) (v-raf-leukemia viral oncogene 1) Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89264-958
Supplier: Genetex
Image Unavailable-89328-960

Chicken Polyclonal antibody to C-raf (v-raf-1 murine leukemia viral oncogene homolog 1)

Description: Purity: Affinity chromatography purified via peptide column Species Reactivity: Human, Mouse, Rat Tested Applications: ELISA, WB Pkg Size: 100 ug
Catalog Number: 89328-960
Supplier: Genetex
Image Unavailable-10292-552

INTEGRIN ALPHA V + BETA 3 CD51+CD61

Description: INTEGRIN ALPHA V + BETA 3 CD51+CD61 Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: CD51; MSK8; VNRA; VTNR; GT; CD61; GP3A; BDPLT2, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10292-552
Supplier: Bioss
2,497 - 2,512 of 16,715