Print…

You Searched For: viral+rna


16,841  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"16841"

Rate These Search Results

Product Image-10789-050

Recombinant Human Interferon-alpha 2b (IFNa-2b) contains 166 AAs

Description: Recombinant Human Interferon-alpha 2b (IFNa-2b) contains 166 AAs, with a MW of 19. 4 kDa. Activity: ability induce antiviral activity. Source: E. Coli. Lyophilized and stable at -20 degree C. Synonyms: Type I Interferon, Alpha 2, 20UG
Catalog Number: 10789-050
Supplier: Shenandoah Biotechnology
Product Image-10822-048

Recombinant, Human, Interferon-alpha 2b

Description: Recombinant, Human, Interferon-alpha 2b, Source:   E. Coli, Purity: greater than or equal to 98% as determined by Reducing and Non-reducing SDS-PAGE, non-glycosylated protein, 166 amino acids, 19. 4kDa, Synonyms: Type I Interferon, Alpha 2, Size: 250ug
Catalog Number: 10822-048
Supplier: Shenandoah Biotechnology
Product Image-10789-046

Recombinant Human Interferon-alpha 2b (IFNa-2b) contains 166 AAs

Description: Recombinant Human Interferon-alpha 2b (IFNa-2b) contains 166 AAs, with a MW of 19. 4 kDa. Activity: ability induce antiviral activity. Source: E. Coli. Lyophilized and stable at -20 degree C. Synonyms: Type I Interferon, Alpha 2, 1MG
Catalog Number: 10789-046
Supplier: Shenandoah Biotechnology
Image Unavailable-89287-518

MS MAB to ERBB3

Description: Mouse Monoclonal antibody to ERBB3 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)) Clone: 3F10F6 Species Reactivity: Human Tested Applications: ELISA IHC Pkg Size: 100 ul
Catalog Number: 89287-518
Supplier: Genetex
Image Unavailable-89274-406

MS MAB to BRAF

Description: Mouse Monoclonal antibody to BRAF (v-raf murine sarcoma viral oncogene homolog B1) Clone: 4B2 Purity: Protein A/G affinity chromatography Species Reactivity: Human Monkey Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89274-406
Supplier: Genetex
Image Unavailable-89274-392

MS MAB to BRAF

Description: Mouse Monoclonal antibody to BRAF (v-raf murine sarcoma viral oncogene homolog B1) Clone: 1D2 Purity: Protein A/G affinity chromatography Species Reactivity: Human Tested Applications: FACS ICC/IF WB Pkg Size: 100 ul
Catalog Number: 89274-392
Supplier: Genetex
Image Unavailable-89328-384

Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)

Description: Purity: Protein A purified Species Reactivity: Human, Mouse, Rat Tested Applications: WB Pkg Size: 250 ug
Catalog Number: 89328-384
Supplier: Genetex
Image Unavailable-89304-044

RB PAB to RAF1 (S259)

Description: Rabbit Polyclonal antibody to Raf1 (Phospho Ser259) (v-raf-1 murine leukemia viral oncogene homolog 1) Purity: affinity-chromatography using epitope-specific phosphopeptide. Species Reactivity: Human Mouse Rat Tested Applications:IHC WB Pkg Size: 100 ul
Catalog Number: 89304-044
Supplier: Genetex
Image Unavailable-89304-702

RB PAB to HER2

Description: Rabbit Polyclonal antibody to HER2 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 2 ) Purity: Affinity-chromatography using epitope-specific peptide. Species Reactivity: Human Mouse Rat Tested Applications: ICC/IF IHC WB Pkg Size: 100 ul
Catalog Number: 89304-702
Supplier: Genetex
Image Unavailable-76420-672

Facemask MEA210-0

Description: Looped Face Mask MEA210-0, Non-sterile, Material: Polypropylene, Polyethylene, Color: White, String Type: Ear Loops, Cleanroom Class: Class 10/Iso 4, High bacterial, viral & particle efficiency filtration, Looped with connector for secure fastening, Dimension: 5mm
Catalog Number: 76420-672
Supplier: Ansell Healthcare
Image Unavailable-76195-714

HIV Type-1 p24 Monoclonal antibody 100ug

Description: HIV Type-1 p24 Monoclonal antibody, Clone: HIV1-24/661, Host: Mouse, Species Reactivity: Human, Isotype: IgG1, kappa, Immunogen: Recombinant HIV-1 Gag p24 protein was used as the immunogen for this antibody, Application: ELISA, ICC, IF, Size: 100ug
Catalog Number: 76195-714
Supplier: Prosci
Product Image-10106-160

CEBPG Antibody

Description: Polyclonal, Host:Rabbit, Species reactivity:Human, Immunogen:Produced in rabbits immunized with a synthetic peptide corresponding a region of human CEBPG, purified by peptide affinity chromatography method, Application:Elisa, 50ug
Catalog Number: 10106-160
Supplier: Prosci
Product Image-89421-528

Antibody Hemagglutin Monoclonal 0.1MG

Description: Avian Influenza Hemagglutinin (1E7D8)
Catalog Number: 89421-528
Supplier: Prosci
Image Unavailable-103008-214

Prostatic Acid Phosphatase (248-286) 1mg

Description: Prostatic Acid Phosphatase (248-286), PAP (248-286), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4551.5, Sequence: GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY, Appearance: Powder, SEVI factor found in semen, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-214
Supplier: Anaspec Inc
Image Unavailable-102988-410

Ganglioside GD1a disodium salt 1MG

Description: Ganglioside GD1a disodium salt (bovine brain), Purity: >/=98% (TLC), Cas Number: 12707-58-3, Formula: C84H146N4O39. 2Na, Molecular Weight: 1836.1, Appearance: Lyophilized, Soluble in water, Synonyms: GD1a. 2Na, Disialoganglioside GD1a. 2Na, Size: 1MG
Catalog Number: 102988-410
Supplier: Adipogen
Image Unavailable-102988-412

Ganglioside GD1a disodium salt 5MG

Description: Ganglioside GD1a disodium salt (bovine brain), Purity: >/=98% (TLC), Cas Number: 12707-58-3, Formula: C84H146N4O39. 2Na, Molecular Weight: 1836.1, Appearance: Lyophilized, Soluble in water, Synonyms: GD1a. 2Na, Disialoganglioside GD1a. 2Na, Size: 5MG
Catalog Number: 102988-412
Supplier: Adipogen
2,529 - 2,544 of 16,841