You Searched For: viral+rna


12,688  results were found

SearchResultCount:"12688"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103008-214)
Supplier: Anaspec Inc
Description: Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.
Sequence:GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
MW:4551.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (89296-120)
Supplier: Genetex
Description: Goat polyclonal antibody to REL


Catalog Number: (MSPP-100-0676)
Supplier: Stemcell Technologies
Description: The SARS-CoV-2 (spike protein) peptide pool is provided as two lyophilized mixtures (subpools) from the SARS-CoV-2 spike protein. Each subpool contains 158 peptides, for a total of 316 peptides. The virus attaches to the cell membrane of the host through the interaction between spike protein and angiotensin-converting enzyme 2 (ACE2) receptor, and the spike protein plays a critical role in viral entry. The subpools consist of 15-mer peptides with 11-amino-acid overlaps that cover amino acids 1 to 1273 on the spike protein.

New Product


Catalog Number: (10229-436)
Supplier: Bioss
Description: Phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters. Transcription activation is enhanced by the TORC coactivators which act independently of Ser-133 phosphorylation. Involved in different cellular processes including the synchronization of circadian rhythmicity and the differentiation of adipose cells.


Catalog Number: (102511-892)
Supplier: Adipogen
Description: Human CD4 is a cell surface glycoprotein of 55kDa expressed on most thymocytes, on about two thirds of peripheral T cells and on some monocyte macrophage lineage cells. CD4 interacts with MHC Class II molecules in an accessory role during foreign antigen recognition by T cells. The extracellular portion of CD4 is an array of four Ig-like domains. The N-terminal region of CD4 is a receptor for the HIV-1 viral protein gp120.

Small Business Enterprise


Catalog Number: (102511-900)
Supplier: Adipogen
Description: Human CD4 is a cell surface glycoprotein of 55kDa expressed on most thymocytes, on about two thirds of peripheral T cells and on some monocyte macrophage lineage cells. CD4 interacts with MHC Class II molecules in an accessory role during foreign antigen recognition by T cells. The extracellular portion of CD4 is an array of four Ig-like domains. The N-terminal region of CD4 is a receptor for the HIV-1 viral protein gp120.

Small Business Enterprise


Catalog Number: (10229-788)
Supplier: Bioss
Description: Phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters. Transcription activation is enhanced by the TORC coactivators which act independently of Ser-133 phosphorylation. Involved in different cellular processes including the synchronization of circadian rhythmicity and the differentiation of adipose cells.


Catalog Number: (10068-774)
Supplier: Prosci
Description: This protein binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. CREB stimulates transcription on binding to the CRE. Transcription activation is enhanced by the TORC coactivators which act independently of Ser-133 phosphorylation. Implicated in synchronization of circadian rhythmicity.


Catalog Number: (102512-754)
Supplier: Adipogen
Description: Human CD272 (BTLA; B and T Lymphocyte Attenuator) is a member of the immunoglobulin superfamily and has sequence homology to PD-1 and CTLA-4. It is expressed on T and B lymphocytes and other hemopoetic lineages. Engagement of this molecule by its ligand CD270 (HVEM) can downregulate activated T and B cell responses. CD272 levels on antigen specific CD8+ T cells have been reported to decrease in viral specific, but not melanoma specific activated lines. Polymorphism of the CD272 molecule has been linked to rheumatoid arthritis.

Small Business Enterprise


Catalog Number: (10231-858)
Supplier: Bioss
Description: Severe acute respiratory syndrome (SARS) is a viral respiratory illness caused by a coronavirus, called SARS-associated coronavirus (SARS-CoV). Human coronaviruses (HCoVs) were previously only associated with mild diseases. The SARS-CoV genome contains five major open reading frames (ORFs) that encode the replicase polyprotein; the spike (S), envelope (E), and membrane (M) glycoproteins; and the nucleocapsid protein (N).


Catalog Number: (89302-036)
Supplier: Genetex
Description: Rabbit polyclonal to MYCN (C-term)


Catalog Number: (10236-992)
Supplier: Bioss
Description: This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Binds to the Tax-responsive element (TRE) of HTLV-I. Mediates PKA-induced stimulation of CRE-reporter genes. Represses the expression of FTH1 and other antioxidant detoxification genes. Triggers cell proliferation and transformation.


Catalog Number: (89365-398)
Supplier: Genetex
Description: Rabbit polyclonal antibody to NFkB p65


Supplier: Adipogen
Description: The CD137 ligand (CD137L, 4-1BBL) is a member of the tumor necrosis factor (TNF) family. CD137L is a type II, transmembrane protein found on activated macrophages, dendritic cells and mature B cells. The interaction with its receptor 4-1BB induces recruitment of TNF receptor-associated factor 1 (TRAF1) and TRAF2 and interaction with the kinase p56lck. CD137 and CD137L have been reported to be involved in tumor rejection, apoptosis, anti-viral immunity, diabetes, in T and B cell co-stimulation and modulation of the immune response.

Catalog Number: (10798-962)
Supplier: Heathrow Scientific
Description: eShield™ sterile cell phone covers are designed to protect a sterile environment from contaminants on smart phones.


Catalog Number: (89303-416)
Supplier: Genetex
Description: Mouse monoclonal antibody [1H1B11] to ABL2


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,633 - 1,648 of 12,688
no targeter for Bottom