You Searched For: stxbp3


330  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"330"
Description: Anti-Phospho-Ser241 Munc18-1, Polyclonal antibody, Host: Rabbit, Species: Rat, Isotype: Igg, Immunogen: repeated immunizations with a synthetic phospho-peptide corresponding to amino acid residues surrounding Ser241, Synonyms: MYBPC1 Antibody, WB, Size: 100ul
Catalog Number: 75930-162
Supplier: Rockland Immunochemical


Description: Polyclonal, Host: Goat, Species: Human, Immunogen: Amisyn antibody was raised against a 13 amino acid synthetic peptide near the N-Terminus of Amisyn, Application: ELISA, IHC
Catalog Number: 10112-402
Supplier: Prosci


Catalog Number: 77725-315
Supplier: AFG BIOSCIENCE LLC

New Product


Catalog Number: 77725-316
Supplier: AFG BIOSCIENCE LLC

New Product


Description: STXBP1, Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: Recombinant Human STXBP1 Protein, Synonyms: Anti-MUNC18-1 Antibody;Anti-NSEC1 Antibody;Anti-P67 Antibody;Anti-RBSEC1 Antibody;Anti-UNC18 AntibodyMunc18-1, Size: 100 ul
Catalog Number: 103635-430
Supplier: Sino Biological


Description: STXBP2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 184-215aa QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD, Synonyms: protein unc-18 homolog B, Unc-18B, STXBP2, UNC18B, Application: WB, Size: 100ug/vial
Catalog Number: 76174-496
Supplier: Boster Biological Technology


Description: Polyclonal Antibody Anti-Stxbp5, Host Species: Rabbit, Cross Reactivity: Human, Rat, Immunogen: Fusion Protein, 515-610 Amino Acid Format:Antigen Affinity Purification, Application: Elisa, Wb, Ip, Recommended Storage: - 20degree C or Lower
Catalog Number: 10155-220
Supplier: Proteintech


Catalog Number: 102245-732
Supplier: Novus Biologicals


Description: Polyclonal, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: produced in rabbits immunized with a synthetic peptide corresponding a region of human SSBP3, purified by peptide affinity chromatography method, Application: ELISA, western blot, 50ug.
Catalog Number: 10104-324
Supplier: Prosci


Description: Location: 15 amino acids near the amino terminus of human SteAP3, Species: Human, tested Application: Bl, Application: SteAP3 peptide is used for blocking the activity of SteAP3 antibody, Concentration: 200 ug/mL, Storage Condition: At -20C, stable for one year.
Catalog Number: 89419-504
Supplier: Prosci


Description: STEAP3 polyclonal antibody, Rabbit polyclonal antibody raised against synthetic peptide of STEAP3, Size: 100 ug
Catalog Number: 10739-798
Supplier: Abnova


Catalog Number: 102151-678
Supplier: Novus Biologicals


Description: Anti-STRBP Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, C-term-350 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, Recommended Storage: - 20 C or lower
Catalog Number: 10095-350
Supplier: Proteintech


Catalog Number: 102189-516
Supplier: Novus Biologicals


Catalog Number: 102711-914
Supplier: Novus Biologicals


Catalog Number: 77801-314
Supplier: AFG BIOSCIENCE LLC

New Product


129 - 144 of 330