You Searched For: stard3


5,101  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5101"
Description: Label, Adhesive, Material: Vinyl, Use this caution label to indicate the presence of ultraviolet light and to not stare at the light.
Catalog Number: 103459-088
Supplier: HCL Label


Catalog Number: 10368-890
Supplier: Bioss


Description: Sampling stand used to support cassettes at elevated levels. ABS-1 Deluxe Sampling Stand: very similar to the economy stand but made in the USA from aluminum. Better durability and stability than the economy one.
Catalog Number: 102681-136
Supplier: Electron Microscopy Sciences


Catalog Number: 89201-994
Supplier: Simport Scientific


Catalog Number: 470345-608
Supplier: Wards


Description: PARD3/Par3, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Immunogen: LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR, Application: WB, Simple Western, ICC/IF, IHC, IHC-P, Size: 100UL
Catalog Number: 103276-138
Supplier: Novus Biologicals


Catalog Number: ABCA_AB84177-100UG
Supplier: ABCAM INC.

New Product


Description: Polyclonal antibody Smad3 (phospho Ser425) Host: Rabbit Species reactivity: Human, Mouse, Rat immunogen: raised against a peptide sequence around phosphorylation site of serine 425 (C-S-S-V-S (p) ) derived from Human Smad3. Tested application: WB, IHC, IF
Catalog Number: 10070-268
Supplier: Prosci


Catalog Number: 470343-794
Supplier: Wards


Description: Signal transducer and activator of transcription 3 (acute-phase response factor) Clone: 7G3H4 Species Reactivity: Human Tested Applications: ELISA Pkg Size: 100 ul
Catalog Number: 89353-890
Supplier: Genetex


Description: Polyclonal, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: STAT3 (Ab-727) antibody was raised against a peptide sequence around aa. 725 approximately 729 (P-M-S-P-R) derived from Human STAT3, Tested Applications: Western blotting, Immuno histochemistry
Catalog Number: 10068-800
Supplier: Prosci


Catalog Number: 470344-886
Supplier: Wards


Catalog Number: 470345-144
Supplier: Wards


Description: Durable Sherpa Infobase Sign Stand, Acrylic/Metal, 40-60 High, Gray
Catalog Number: 500025-480
Supplier: Janitorial Supplies


Description: 8 pc metric t handle w/stand 2-10 mm
Catalog Number: 300001-796
Supplier: Safety & Industrial Supplies


Description: Starting Punch, type: Tapered, Material: Tool Steel, Overall Length: 5 5/8 in, Stock Shape: Hex, Tip Size: 3/16 in, Tip Type: Round, Heavier, shorter body and wider point than drift punch, For installing pins and rivets
Catalog Number: 76190-752
Supplier: Safety & Industrial Supplies


1,281 - 1,296 of 5,101