You Searched For: Chembridge Europe


4,656  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"4656"
Description: Oligodendrocyte Marker O4, monoclonal antibody, Host: Mouse, Clone: O4, Isotype: IgM, Species reactivity: Human, Mouse, Rat, Chicken, Format: Phycoerythrin, Immunogen: Bovine brain corpus callosum white matter, Size: 100 tests
Catalog Number: 220017-039
Supplier: R&D Systems


Description: TMEM59L/BSMAP Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: BSMAP; Brain-specic membrane-anchored protein, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10260-362
Supplier: Bioss


Description: EOMES, Polyclonal Antibody, Host: Sheep, Species reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived recombinant human EOMES, Synonyms: T-box brain2, TBR2, TBR-2, TBR2eomesodermin homolog, T-brain-2, Application: WB, Immunocytochemistry, Size: 100ug
Catalog Number: 103231-112
Supplier: Novus Biologicals


Description: TMEM59L/BSMAP Polyclonal Antibody, Host: Rabbit, Cy7 Conjugated, Emmission: 743nm/767nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: BSMAP; Brain-specic membrane-anchored protein, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10260-360
Supplier: Bioss


Description: CD90 Monoclonal antibody, Clone: F15-42-1-5, Host: Mouse, Species reactivity: Human, Monkey, Isotype: IgG1, kappa, Conjugate: CF594, Immunogen: Purified human brain Thy1Unigene 644697, Application: Immunofluorescence, Flow cytometry, Size: 100uL
Catalog Number: 75908-674
Supplier: Biotium


Description: CD90 Monoclonal antibody, Clone: F15-42-1-5, Host: Mouse, Species reactivity: Human, Monkey, Isotype: IgG1, kappa, Conjugate: CF405S, Immunogen: Purified human brain Thy1Unigene 644697, Application: Immunofluorescence, Flow cytometry, Size: 100uL
Catalog Number: 75908-654
Supplier: Biotium


Description: CD90 Monoclonal antibody, Clone: F15-42-1-5, Host: Mouse, Species reactivity: Human, Monkey, Isotype: IgG1, kappa, Conjugate: CF488A, Immunogen: Purified human brain Thy1Unigene 644697, Application: Immunofluorescence, Flow cytometry, Size: 100uL
Catalog Number: 75908-658
Supplier: Biotium


Description: POU3F2, Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: 18 amino acid peptide near the C-terminus, Synonyms: Nervous system-specific octamer-binding transcription factor N-Oct-3, Brain-2, Size: 100 UG
Catalog Number: 75931-116
Supplier: Rockland Immunochemical


Description: TMEM59L/BSMAP Polyclonal Antibody, Host: Rabbit, Cy5 Conjugated, Emmission: 625, 650nm/670nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: BSMAP; Brain-specic membrane-anchored protein, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10260-358
Supplier: Bioss


Description: [Pyr3] - beta - Amyloid (3 - 42), Human, Purity: HPLC >/= 95%, Sequence (One-Letter Code) Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, MW: 4309.9, deposited in human brain of Alzheimer's disease and Down's syndrome patients, Storage: -20deg C, Size: 1mg
Catalog Number: 102997-274
Supplier: Anaspec Inc


Description: Tissue grinding CKMix50 - 7mL includes 50 preps of a ceramic (zirconium oxide) mix beads of 2.8 and 5.0mm in 7mL standard tubes with O-ring. CKMix50 is designed for grinding whole rat brain, kidney, skin, iris-ciliary body pork or dry samples. Sample size range:200mg to 2g tissue or 200µL to 6mL
Catalog Number: 10144-534
Supplier: BERTIN CORP


Description: [Pyr3] - beta - Amyloid (3-42), Human, Purity: HPLC >/= 95%, Sequence (One-Letter Code) Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, MW: 4309.9, deposited in human brain of Alzheimer's disease & Down's syndrome patients, Storage: -20deg C, Size: 0.1mg
Catalog Number: 102997-272
Supplier: Anaspec Inc


Description: Beta - Amyloid (1 - 40), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9, post-secretory aggregation and deposition in the Alzheimer’s disease brain, Size: 5 mg
Catalog Number: 102999-794
Supplier: Anaspec Inc


Description: Dyrktide, Sequence: RRRFRPASPLRGPPK, Purity: By HPLC greater than or equal to 95%, optimal substrate sequence efficiently phosphorylated by DYRK1A involved in brain development, Molecular Weight: 1791.2, Apperance: White powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-484
Supplier: Anaspec Inc


Description: BEX4 Polyclonal Antibody, Host: Rabbit , Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: BEXL1; NADE3; BEX1 like 1; brain expressed gene 4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10474-114
Supplier: Bioss


Description: Clone number GA5, This antibody reacts with the 52 kD intermediate filament protein GFAP in brain and spinal cord. It labels some astrocytes and some CNS ependymal cells but not oligodendrocytes or neurons. This antibody does not react with other intermediate filament proteins.
Catalog Number: 99990-830
Supplier: Diagnostic Biosystems


-239 - -224 of 4,656