Print…

You Searched For: stab1


3,889  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"3889"

Rate These Search Results

Product Image-10738-762

SNAI1 antibody

Description: SNAI1 monoclonal antibody, clone: 6D2, Host: Mouse, Species reactivity: Human, Immunogen: Recombinant protein corresponding to human SNAI1, Application: Western Blot, Size: 100 uL
Catalog Number: 10738-762
Supplier: Abnova
Image Unavailable-102209-864

SATB2 Peptide

Catalog Number: 102209-864
Supplier: Novus Biologicals
Image Unavailable-89515-986

SMAP1 (N-Term)

Description: Polyclonal Antibody, Species Reactivity: Human, Isotype: Rabbit Ig, Gene ID: 60682, Target/Specificity: This SMAP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 87-113 amino acids from the N-terminal region of human SMAP1, 1mg
Catalog Number: 89515-986
Supplier: Abgent
Image Unavailable-10324-002

SMAD1 Antibody

Description: SMAD1 Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Isotype: IgG, Synonymns: Mothers against decapentaplegic homolog 5, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10324-002
Supplier: Bioss
Image Unavailable-89517-822

NTAN1 (C-Term)

Description: Polyclonal antibody, Isotype: Rabbit Ig, Species Reactivity: Human , Gene ID: 123803 , Target/Specificity: generated from rabbits immunized with a KLH conjugated synthetic peptide between 203-230 amino acids from the C-terminal region of human NTAN1
Catalog Number: 89517-822
Supplier: Abgent
Image Unavailable-102215-370

ATAD1 Antibody

Catalog Number: 102215-370
Supplier: Novus Biologicals
Image Unavailable-10719-784

ITGB1 Antibody

Description: ITGB1 monoclonal antibody, clone DF5, Host: Mouse, Species: Human, Isotype: IgG1, Immunogen: Native purified human ITGB1, Application: Western Blot, Immunohistochemistry, Size: 100UG
Catalog Number: 10719-784
Supplier: Abnova
Product Image-76064-556

SKAP1 polyclonal antibody 400uL

Description: SKAP1, polyclonal antibody, Host: Rabbit, Species: Human, Isotype: Ig, Immunogen: KLH conjugated synthetic peptide between 266-295 amino acids from the C-terminal region of human SKAP1, Synonyms: SKAP-55, pp55, SKAP1, SCAP1, SKAP55, Application: WB, Size: 400uL
Catalog Number: 76064-556
Supplier: Prosci
Product Image-76009-998

SATL1 Polyclonal Antibody 400ul

Description: SATL1 Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: Igg, Immunogen: generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-351 amino acids from the C-terminal region of human SATL1. Synonyms: 231-, SATL1, Size: 400ul
Catalog Number: 76009-998
Supplier: Prosci
Product Image-10368-782

SMAD1/5 SER463/SER465 ANTIBODY

Catalog Number: 10368-782
Supplier: Bioss
Image Unavailable-89304-514

RB PAB to SMAD1 (S465)

Description: Rabbit Polyclonal antibody to Smad1 (Phospho Ser465) (SMAD family member 1) Purity: affinity-chromatography using epitope-specific phosphopeptide. Species Reactivity: Human Mouse Rat Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89304-514
Supplier: Genetex
Image Unavailable-77688-964

OTUB1 ANTIBODY A39882-100UG

Catalog Number: 77688-964
Supplier: AFG BIOSCIENCE LLC

New Product


Image Unavailable-10372-558

SMAD1/5 SER463/SER465 ANTIBODY

Catalog Number: 10372-558
Supplier: Bioss
Image Unavailable-10261-426

KMT1E/SETDB1/ESET Antibody

Description: KMT1E/SETDB1/ESET Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: ERG-associated protein with SET domain; ESET, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10261-426
Supplier: Bioss
Image Unavailable-103280-338

ETAA1 Polyclonal antibody 100UL

Description: ETAA1, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: human, Immunogen: DMPELFPSKTAHVTDQKEICTFNSKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNK, Synonyms: wing tumor-associated antigen 1, Application: WB, ICC/IF, IHC, IHC-P, Size: 100UL
Catalog Number: 103280-338
Supplier: Novus Biologicals
Image Unavailable-77688-677

SNAI1 ANTIBODY A35241-100UG

Catalog Number: 77688-677
Supplier: AFG BIOSCIENCE LLC

New Product


1,409 - 1,424 of 3,889