You Searched For: stab1


3,889  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"3889"
Catalog Number: 10368-782
Supplier: Bioss


Description: Rabbit Polyclonal antibody to Smad1 (Phospho Ser465) (SMAD family member 1) Purity: affinity-chromatography using epitope-specific phosphopeptide. Species Reactivity: Human Mouse Rat Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89304-514
Supplier: Genetex


Catalog Number: 77688-964
Supplier: AFG BIOSCIENCE LLC

New Product


Catalog Number: 10372-558
Supplier: Bioss


Description: KMT1E/SETDB1/ESET Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: ERG-associated protein with SET domain; ESET, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10261-426
Supplier: Bioss


Description: ETAA1, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: human, Immunogen: DMPELFPSKTAHVTDQKEICTFNSKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNK, Synonyms: wing tumor-associated antigen 1, Application: WB, ICC/IF, IHC, IHC-P, Size: 100UL
Catalog Number: 103280-338
Supplier: Novus Biologicals


Catalog Number: 77688-677
Supplier: AFG BIOSCIENCE LLC

New Product


Catalog Number: ABCA_AB235053-100U
Supplier: ABCAM INC.

New Product


Catalog Number: 77701-395
Supplier: AFG BIOSCIENCE LLC

New Product


Description: Rabbit Polyclonal antibody to Smad1 (phospho Ser465) (SMAD family member 1) Purity: Affinity purified with antigen Species Reactivity: Human Mouse Rat Tested Applications: WB Pkg Size: 100 ug
Catalog Number: 89276-484
Supplier: Genetex


Description: IFNB1, Recombinant protein, Purity: > 95 % as determined by SDS-PAGE, Host: CHO Stable Cells, Species: Human, Molecular Mass: The recombinant human IFNB consists of 166 amino acids and predicts a molecular mass of 20 kDa, Purification: <1.0EU/Ug, Size: 1 mg
Catalog Number: 103678-974
Supplier: Sino Biological


Description: REG4 / RELP / GISP Protein (His Tag) Recombinant, Purity: > 85 % as determined by SDS-PAGE, Host: CHO Stable Cells, Species: Human, Immunogen: The recombinant human REG4 consists of 147 amino acids and predictes a molecular mass of 17.4 kDa, size: 100ug
Catalog Number: 103621-978
Supplier: Sino Biological


Description: NOTCH1 recombinant protein, Purity: > 90 % as determined by SDS-PAGE, Host: CHO Stable Cells, Species: Mouse, Endotoxin: < 1.0 EU per ug protein, Molecular mass: The recombinant mouse Notch1 consists 749 aa and pred
Catalog Number: 103667-808
Supplier: Sino Biological


Catalog Number: 103621-466
Supplier: Sino Biological


Description: SNAI1 (Human) Matched Antibody Pair to detect and quantify protein level of human SNAI1. Size: 1 Set
Catalog Number: 10542-892
Supplier: Abnova


Catalog Number: 77582-746
Supplier: Sino Biological

New Product


1,409 - 1,424 of 3,889