You Searched For: Alpha Protech


3,889  results were found

SearchResultCount:"3889"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (10681-446)
Supplier: Abnova
Description: SNAI1 polyclonal antibody, Rabbit polyclonal antibody raised against synthetic peptide of SNAI1, Reactivity: Human, Isotype: IgG, Application: Elisa, Western blot, Immunohistochemistry, Size: 400 uL


Catalog Number: (77444-570)
Supplier: Sino Biological


Catalog Number: (76196-414)
Supplier: New England Biolabs (NEB)
Description: NEB* 10-beta/Stable Outgrowth Medium, Outgrowth Medium recommended for use with NEB 10-beta or NEB Stable Competent E. Coli, Use to dilute the outgrowth prior to plating, Size: 100 ml (4 x 25 ml)


Catalog Number: (102864-638)
Supplier: Bon Opus Biosciences
Description: Produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Val712) of Human STAT1.10ug


Catalog Number: (102864-644)
Supplier: Bon Opus Biosciences
Description: Produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Val712) of Human STAT1.50ug


Catalog Number: (102864-640)
Supplier: Bon Opus Biosciences
Description: Produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Val712) of Human STAT1.1mg


Catalog Number: (102864-642)
Supplier: Bon Opus Biosciences
Description: Produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Val712) of Human STAT1.500ug


Catalog Number: (77719-030)
Supplier: AFG BIOSCIENCE LLC

New Product


Catalog Number: (ABCA_AB51451-100UG)
Supplier: ABCAM INC.

New Product


Catalog Number: (77719-029)
Supplier: AFG BIOSCIENCE LLC

New Product


Catalog Number: (77719-031)
Supplier: AFG BIOSCIENCE LLC

New Product


Catalog Number: (77719-032)
Supplier: AFG BIOSCIENCE LLC

New Product


Catalog Number: (76171-138)
Supplier: Boster Biological Technology
Description: SMAD1/SMAD5 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human SMAD1/SMAD5 (KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK), Synonym: BSP-1, SMAD1, Application: WB, Size:100ug


Catalog Number: (103310-144)
Supplier: Novus Biologicals
Description: SIAH1, Monoclonal antibody, Clone: 2C5, Host: Mouse, Species reactivity: Human, Isotype: IgG1 Kappa, Immunogen: SIAH1 (1aa-110aa) partial recombinant protein, Synonyms: E3 ubiquitin-protein ligase SIAH1, EC 6.3.2, EC 6.3.2.-, Application: WB, ELISA, Size: 0.1 mg


Catalog Number: (103359-870)
Supplier: Novus Biologicals
Description: Anti-STAM1 Mouse Monoclonal Antibody (DyLight 350) [clone: 29C678]


Catalog Number: (PAV6564)
Supplier: Promega Corporation
Description: Tak1-Tab1 Kinase Enzyme System, Easily Screen and Profile Tak1-Tab1 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg

SDS


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
129 - 144 of 3,889
no targeter for Bottom