Print…

You Searched For: silver


613,122  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613122"

Rate These Search Results

Image Unavailable-103012-264

Human BMP-2 Protein Tag Free 200ug

Description: Human BMP-2 Protein, Tag Free, Host: HEK293 cells, Species Reactivity: Human, purity: >92% SDS-PAGE, Molecular Characterization: calculated MW of 13 kDa, Endotoxin: Less than 1.0 EU per ug of the Human BMP-2, Synonym: BMP2,BMP2A, Storage: 4 Degree C, size: 200ug
Catalog Number: 103012-264
Supplier: ACROBIOSYSTEMS
Image Unavailable-103002-742

Aminopeptidase N Ligand (CD13), NGR peptide 5mg

Description: Aminopeptidase N Ligand (CD13), NGR peptide, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 606.7, Sequence: (One-Letter Code) CNGRCG (Disulfide bridge: 1-5), Appearance: White Powder, Storage: At -20 Degree C, Size: 5mg
Catalog Number: 103002-742
Supplier: Anaspec Inc
Image Unavailable-103012-382

Human Semaphorin 4D/SEMA4D/CD100 Protein 1mg

Description: Human Semaphorin 4D/SEMA4D/CD100 Protein, Host: HEK293 cells, species reactivity: human, Purity: >95% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW of 105.4 kDa, Synonym: SEMA4D, CD100, Size: 1mg
Catalog Number: 103012-382
Supplier: ACROBIOSYSTEMS
Image Unavailable-103815-204

IL-17 RE (155-454) Protein, Species Reactivity: Human, Host: HEK293, Purity: >95% as determined by SDS-PAGE, Molecular Weight: 60.5 kDa, Molecular Characterization: protein carries a human IgG1 Fc tag at C-terminus, Synonym: IL-17 RE, IL17RE, Size: 1mg

Description: IL-17 RE (155-454) Protein, Species Reactivity: Human, Host: HEK293, Purity: >95% as determined by SDS-PAGE, Molecular Weight: 60.5 kDa, Molecular Characterization: protein carries a human IgG1 Fc tag at C-terminus, Synonym: IL-17 RE, IL17RE, Size: 1mg
Catalog Number: 103815-204
Supplier: ACROBIOSYSTEMS
Image Unavailable-103003-726

Exendin 4 1 mg

Description: Exendin 4, Purity: HPLC >/- 95%, Molecular Weight: 4186.6, Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Appearance: Lyophilized white powder, is an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake, Size: 1 mg
Catalog Number: 103003-726
Supplier: Anaspec Inc
Image Unavailable-103006-594

P53 (17-26) 1 mg

Description: P53 (17-26) sequence contains the residues that contact the binding domain of Mdm-2, important in maintaining genome stability and preventing cancer development, Purity: HPLC>/=95%, Sequence (One-Letter Code): ETFSDLWKLL, Molecular weight: 1251.5, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-594
Supplier: Anaspec Inc
Image Unavailable-103014-090

Human CD36/SR-B3 Protein

Description: CD36/SR-B3 Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW 47.5KDa, Synonyms: CD36,SCARB3,BDPLT10,CHDS7,FAT,GP3B,GP4, Storage: 4 deg C, Size: 100ug
Catalog Number: 103014-090
Supplier: ACROBIOSYSTEMS
Image Unavailable-103006-236

C - peptide dog 0.5mg

Description: C - peptide, dog, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): EVEDLQVRDVELAGAPGEGGLQPLALEGALQ, Molecular Weight: 3174.5, Physical State: Powder, Insulin secretory rate can be estimated, Storage: -20 degree C, Size: 0.5mg
Catalog Number: 103006-236
Supplier: Anaspec Inc
Image Unavailable-103007-238

Pro - apoptotic Peptide, klaklakklaklak 1 mg

Description: Pro - apoptotic Peptide, klaklakklaklak, 5 - FAM - labeled, Sequence: 5 - FAM - klaklakklaklak - NH2, Purity: HPLC greater than or equal to 95%, composed of D-amino acids, 5-FAM labeled, Molecular Weight: 1881.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-238
Supplier: Anaspec Inc
Image Unavailable-103815-206

IL-17 RE (155-454) Protein, Species Reactivity: Human, Host: HEK293, Purity: >95% determined by SDS-PAGE, Molecular Weight: 60.5 kDa, Molecular Characterization: protein carries human IgG1 Fc tag at C-terminus, Synonym: IL-17 RE, IL17RE, IL17RE, Size: 100ug

Description: IL-17 RE (155-454) Protein, Species Reactivity: Human, Host: HEK293, Purity: >95% determined by SDS-PAGE, Molecular Weight: 60.5 kDa, Molecular Characterization: protein carries human IgG1 Fc tag at C-terminus, Synonym: IL-17 RE, IL17RE, IL17RE, Size: 100ug
Catalog Number: 103815-206
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-728

Recom HEK293 PE PD-1 PDCD1 human 50TEST

Description: PE-Labeled PD-1 PDCD1 Protein, Fc Tag, Recombinant, Source: HEK293, Species: human, Molecular weight: 44.7 kDa, Synonyms: PDCD1, PD1, CD279, SLEB2, Size: 50TEST
Catalog Number: 103790-728
Supplier: ACROBIOSYSTEMS
Image Unavailable-102998-422

ACTH (1 - 39), human 1mg

Description: ACTH (1 - 39), human, cleavage product from a larger precursor proopiomelanocortin (POMC), Purity % Peak Area By HPLC >/=95%, Molecular Weight 4541.1, Sequence (One-Letter Code): SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF, Physical State: Powder, Storage -20 deg C, Size: 1mg
Catalog Number: 102998-422
Supplier: Anaspec Inc
Image Unavailable-103006-920

HSV-gB2 (498-505) 1 mg

Description: HSV-gB2 (498-505) immunodominant epitope gB-8p from herpes simplex virus (HSV) glycoprotein B (gB), Purity: HPLC>/=95%, Sequence (1-Letter Code): SSIEFARL, (3-Letter Code) H-Asn-Glu-Lys-Tyr-Ala-Gln-Ala-Tyr-Pro-Asn-Val-Ser-OH, Molecular weight: 1383.5, Size: 1 mg
Catalog Number: 103006-920
Supplier: Anaspec Inc
Image Unavailable-103006-554

JAG-1 (188-204) Jagged-1 (188-204) Notch Ligand DSL Peptide 1 mg

Description: JAG-1 (188-204), Jagged-1 (188-204), Notch Ligand, DSL Peptide induces epidermal maturation, Purity: HPLC>/=95%, Sequence (One-Letter Code): CDDYYYGFGCNKFCRPR, Molecular weight: 2107.4, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-554
Supplier: Anaspec Inc
Product Image-76446-858

VWR* Cap, Pcr 8-Strip, dome, assorted colors, For use in medical, pharmaceutical and food industry, and molecular biology, Certified free of detectable RNase, DNase, DNA, PCR inhibitors, and tested pyrogen-free

Description: VWR* Cap, Pcr 8-Strip, dome, assorted colors, For use in medical, pharmaceutical and food industry, and molecular biology, Certified free of detectable RNase, DNase, DNA, PCR inhibitors, and tested pyrogen-free
Catalog Number: 76446-858
Supplier: VWR International
Image Unavailable-103007-784

gp91 ds-tat Peptide 2 1 mg

Description: gp91 ds-tat Peptide 2, Sequence: RKKRRQRRRCSTRIRRQL-NH2, Purity: By HPLC greater than or equal to 95%, composed of gp91phox sequence linked to the human immunodeficiency virus-tat peptide, Molecular Weight: 2453, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-784
Supplier: Anaspec Inc
817 - 832 of 613,122