Print…

You Searched For: Mass+Spectrometry


60,444  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"60444"

Rate These Search Results

Image Unavailable-76516-298

Labcoat, Reusable, ESD Sheer NASA Blue 91% Polyester 9% Carbon Short ESD, V-NECK, Snap Front, 3 Patch Pockets, ESD Knit Wrists, Grounding snaps on Waist Pockets, Size: 5XL

Description: Labcoat, Reusable, ESD Sheer NASA Blue 91% Polyester 9% Carbon Short ESD, V-NECK, Snap Front, 3 Patch Pockets, ESD Knit Wrists, Grounding snaps on Waist Pockets, Size: 5XL
Catalog Number: 76516-298
Supplier: Uniform Technology
Image Unavailable-76516-294

Labcoat, Reusable, ESD Sheer NASA Blue 91% Polyester 9% Carbon Short ESD, V-NECK, Snap Front, 3 Patch Pockets, ESD Knit Wrists, Grounding snaps on Waist Pockets, Size: 3XL

Description: Labcoat, Reusable, ESD Sheer NASA Blue 91% Polyester 9% Carbon Short ESD, V-NECK, Snap Front, 3 Patch Pockets, ESD Knit Wrists, Grounding snaps on Waist Pockets, Size: 3XL
Catalog Number: 76516-294
Supplier: Uniform Technology
Image Unavailable-76516-282

Labcoat, Reusable, ESD Sheer NASA Blue 91% Polyester 9% Carbon Short ESD, V-NECK, Snap Front, 3 Patch Pockets, ESD Knit Wrists, Grounding snaps on Waist Pockets, Size: XS

Description: Labcoat, Reusable, ESD Sheer NASA Blue 91% Polyester 9% Carbon Short ESD, V-NECK, Snap Front, 3 Patch Pockets, ESD Knit Wrists, Grounding snaps on Waist Pockets, Size: XS
Catalog Number: 76516-282
Supplier: Uniform Technology
Product Image-76209-968

2-Layered Rubber ESD Tray Liner - 16x 24inch - Royal Blue

Description: 2-Layered Rubber ESD Tray Liner - 16x 24inch - Royal Blue, Thickness: 0.08inch, Color: Royal blue, Hardness: 60 Shore A, Temperature: 190 deg F (87 deg C), Rubber: Premium NBR, Electrical properti
Catalog Number: 76209-968
Supplier: Transforming Technologies
Product Image-13270-792

VWR* Silicone Bath Fluids

Description: 710 fluid. 3.8L bottle. Heat-transfer fluids provide a safe medium for high or low temperatures. Incompatible with Buna or natural rubber. Flash Point: 302[degree]C. Viscosity at 25[degree]C: 500 Centistokes. Temperature range: 150 to 250[degree]C.
Catalog Number: 13270-792
Supplier: VWR International

Product available on GSA Advantage®


Product Image-13270-794

VWR* Silicone Bath Fluids

Description: 510 fluid. 3.8L bottle. Heat-transfer fluids provide a safe medium for high or low temperatures. Incompatible with Buna or natural rubber. Flash Point: 270[degree]C. Viscosity at 25[degree]C: 50 Centistokes. Temperature range: 50 to 150[degree]C.
Catalog Number: 13270-794
Supplier: VWR International

Product available on GSA Advantage®


Product Image-13272-034

VWR* Silicone Bath Fluids

Description: Dynalene HC 50. 1 Gallon. Heat-transfer fluids provide a safe medium for high or low temperatures. Incompatible with Buna or natural rubber. Viscosity: 3.6 Centistokes at 0[degree]C, 15.1 Centistokes at -40[degree]C. Temperature range: -50 to 60[degree]C. Nonflammable.
Catalog Number: 13272-034
Supplier: VWR International

Product available on GSA Advantage®


Image Unavailable-103276-754

ESD Polyclonal antibody 100UL

Description: ESD, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: HDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAG, Synonyms: EC 3.1.2.12, Application: WB, ICC/IF, IHC, IHC-P, Size: 100UL
Catalog Number: 103276-754
Supplier: Novus Biologicals
Image Unavailable-76310-628

Standalone Mat 457 Skystep Esd 2X3In Bk

Description: SKYSTEP* 457 Static dissipative mat, ESD, Color: Black, Standalone rubber mat designed for individual work stations, ESD utilizes the power of air, Designed to suction to the ground to prevent shifting while trapping air in its chambers, Dimension: 2x3in
Catalog Number: 76310-628
Supplier: NOTRAX USA, INC.
Image Unavailable-76310-692

Standalone Mat 457 Skystep Esd 3X5In Bk

Description: SKYSTEP* 457 Static dissipative mat, ESD, Color: Black, Standalone rubber mat designed for individual work stations, ESD utilizes the power of air, Designed to suction to the ground to prevent shifting while trapping air in its chambers, Dimension: 3x5in
Catalog Number: 76310-692
Supplier: NOTRAX USA, INC.
Image Unavailable-76310-958

Standalone Mat 457 Skystep Esd 3X4In Bk

Description: SKYSTEP* 457 Static dissipative mat, ESD, Color: Black, Standalone rubber mat designed for individual work stations, ESD utilizes the power of air, Designed to suction to the ground to prevent shifting while trapping air in its chambers, Dimension: 3x4in
Catalog Number: 76310-958
Supplier: NOTRAX USA, INC.
Product Image-10147-636

ESD safe shop traveler/document holder with yellow header

Description: Holds A size 8 1/2inch x 11inch documents. Includes inner anti-print, non-ESD vinyl liner which will prevent ink transfer. Ideal for use by electronic manufacturers who work with ESD sensitive components. USA made; pack of 10.
Catalog Number: 10147-636
Supplier: Desco
Product Image-76376-238

Tweezers Esd Rubber Coat Style Aa 130Mm

Description: ESD Rubber Coated Boley Tweezers, Style AA, Soft ESD safe cushion grips (resistively 10E8 ohm), ergonomically designed, Anti-Acid/Anti-Magnetic, Stainless steel, Precision tips, straight, sharp, fine, Overall Length: 130 mm, 5 in
Catalog Number: 76376-238
Supplier: ELECTRON MICROSCOPY SCIENCE
Product Image-76490-400

Bottle, Trigger Sprayer Blue, ESD, 8OZ

Description: Bottle, Trigger Sprayer Blue, ESD, 8OZ
Catalog Number: 76490-400
Supplier: Menda
Product Image-76490-404

Bottle, Trigger Sprayer Blue, ESD, 16OZ

Description: Bottle, Trigger Sprayer Blue, ESD, 16OZ
Catalog Number: 76490-404
Supplier: Menda
Product Image-76490-398

Bottle, Trigger Sprayer Yellow, ESD, 8OZ

Description: Bottle, Trigger Sprayer Yellow, ESD, 8OZ
Catalog Number: 76490-398
Supplier: Menda
433 - 448 of 60,444