You Searched For: cytometer


328  results were found

SearchResultCount:"328"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (76480-520)
Supplier: AAT BIOQUEST INC
Description: Rhodamine dyes are used extensively in a variety of biological applications such as fluorescence microscopy, flow cytometry, fluorescence correlation spectroscopy and ELISA.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Supplier: AAT BIOQUEST INC
Description: Flow cytometry combined with fluorescence staining is a powerful tool to analyze heterogeneous cell populations.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Catalog Number: (103879-336)
Supplier: Abnova
Description: Mouse monoclonal antibody raised against native ITGB2.


Supplier: ACROBIOSYSTEMS
Description: FMC63 scFv Monoclonal Antibody, (Y45) (HEK293), Source: expressed from human 293 cells, Isotype: Mouse IgG1/kappa, Specificity: Specifically recognizes the antigen-recognition domain of FMC63 derived CARs, Application: Flow Cytometry, Size: 25tests

Supplier: Streck Laboratories
Description: Cyto-Chex® BCT is a direct draw blood collection tube that maintains cellular morphology and surface antigen expression, including cluster of differentiation (CD) markers prior to analysis by flow cytometry.

Supplier: ACROBIOSYSTEMS
Description: FMC63 scFv Monoclonal Antibody, Avitag, Biotinylated, Source: expressed from human 293 cells, Isotype: Mouse IgG1/kappa, Specificity: Specifically recognizes the antigen-recognition domain of FMC63 derived CARs, Application: Flow Cytometry, Size: 200tests

Catalog Number: (76463-996)
Supplier: Boster Biological Technology
Description: SUR1 ABCC8 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA Alternative Names: SUR1, ABC36, Application: Flow Cytometry, Size: 50ug/vial


Supplier: AAT BIOQUEST INC
Description: PE-Cy5.5 is a popular color used in flow cytometry.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Catalog Number: (103879-332)
Supplier: Abnova
Description: Mouse monoclonal antibody raised against native CD44.


Catalog Number: (76483-504)
Supplier: AAT BIOQUEST INC
Description: It is widely recognized that fluorescent labeling of cells is an effective means to determine total cell numbers or how many viable cells exist in a sample.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (76483-498)
Supplier: AAT BIOQUEST INC
Description: It is widely recognized that fluorescent labeling of cells is an effective means to determine total cell numbers or how many viable cells exist in a sample.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (103889-298)
Supplier: ACROBIOSYSTEMS
Description: FMC63 scFv Monoclonal Antibody, (Y45), PE-Labeled , Source: produced via site-specific conjugation, Isotype: Mouse IgG1/kappa, Specificity: Specifically recognizes the antigen-recognition domain of FMC63 derived CARs, Application: Flow Cytometry, Size: 25tests


Supplier: AAT BIOQUEST INC
Description: PE-Cy5 is a popular color used in flow cytometry.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Catalog Number: (76463-998)
Supplier: Boster Biological Technology
Description: SUR1 ABCC8 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 550, Immunogen: synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA Alternative Names: SUR1, ABC36, Application: Flow Cytometry, Size: 50ug/vial


Supplier: AAT BIOQUEST INC
Description: Fura Red is a visible light-excitable fura-2 analog that offers unique possibilities for ratiometric measurement of calcium ion in single cells by microphotometry, imaging or flow cytometry when used with single excitation, green-fluorescent calcium indicators.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier: AAT BIOQUEST INC
Description: Fura Red is a visible light-excitable fura-2 analog that offers unique possibilities for ratiometric measurement of calcium ion in single cells by microphotometry, imaging or flow cytometry when used with single excitation, green-fluorescent calcium indicators.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
193 - 208 of 328
no targeter for Bottom