You Searched For: CHI+SCIENTIFIC+INC


147,027  results were found

SearchResultCount:"147027"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103388-362)
Supplier: Innovative Research Inc
Description: Factor IX Monoclonal antibody, Clone: 9042, Host: Rat, Species: Mouse, Target Molecular weight: 56 Kda, Antigen: Full length native protein (purified) (Mouse), Application: ELISA, Western Blot, Purity: IgG fraction, Form: Liquid, Storage: -20 deg C, Size: 0.5mg


Catalog Number: (12001-804)
Supplier: Lonza
Description: 2x250ul. Detect as little as 20 pg of dsDNA or 3 ng of RNA. Add GelStar stain prior to gel casting or post stain - no destaining required.

Catalog Number: (12621-148)
Supplier: VWR International
Description: Grinding media for VWR Signature* Pulsing Vortex Mixers (12620-862, -864). Treated to be DNase/RNase-free and useful for preparing samples for molecular biology applications. Size: 800u.

Environmentally Preferable Product available on GSA Advantage®


Catalog Number: (103003-194)
Supplier: Anaspec Inc
Description: 5-FAM-PLSRTLSVSS-NH2, Purity: HPLC >/- 95%, Molecular Weight: 1403.5, Storage -20 deg C, Size 1 mg


Catalog Number: (103007-704)
Supplier: Anaspec Inc
Description: Human Beta-Amyloid (10-35)-Lys(Biotin)-NH₂, Biotin, AnaSpec


Catalog Number: (103011-024)
Supplier: Anaspec Inc
Description: 5-FITC cadaverine, Synonym: 5-((5-Aminopentyl)thioureidyl)fluorescein, fluorescent transglutaminase substrate to label proteins by transaminidation, for biomolecules, Molecular Weight: 564.48, Spectral Properties: Abs/Em = 492/516 nm, Solvent System: DMF or DMSO, Size: 5 mg


Catalog Number: (102996-564)
Supplier: Anaspec Inc
Description: Peptide YY (3-36), human, Purity: HPLC >/= to 95%, Molecular Weight: 4049.5, Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a Y2R agonist, is released from the gastrointestinal tract postprandially, Size: 1 mg


Catalog Number: (102996-560)
Supplier: Anaspec Inc
Description: Peptide YY, human, Purity: HPLC >/= to 95%, Molecular Weight: 4309.8, Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103011-000)
Supplier: Anaspec Inc
Description: Tetramethylrhodamine-5-(and-6) C2 maleimide, Molecular Weight 552.58, Molecular Formula: C31H28N4O6, Spectral Properties: Abs/Em = 544/572nm, Solvent System: DMF or DMSO, Storage: -20 deg C, Store away from oxidizing agent, Form: Solid, Size: 25 mg


Catalog Number: (103385-130)
Supplier: Innovative Research Inc
Description: Human Factor XI total antigen assay ELISA kit, 96 well strip format, Range 0.2-100 ng/ml, Factor XI and XIa will be detected, calibrated against the WHO International Standard for Human Plasma Factor XI (NIBSC Code 04/102), Storage: 4 C


Catalog Number: (103386-840)
Supplier: Innovative Research Inc
Description: Human Factor XI total antigen assay ELISA kit, 96 well strip format, Range 0.2-100 ng/ml, Factor XI and XIa will be detected, calibrated against the WHO International Standard for Human Plasma Factor XI (NIBSC Code 04/102), Size: 5kit


Catalog Number: (103007-326)
Supplier: Anaspec Inc
Description: Tetanus Toxin (830–844), Sequence: QYIKANSKFIGITEL, Purity: By HPLC >/= 95%, This peptide belongs to 830 to 844 amino acid sequence of the tetanus toxin Tc, human, common for most MHC molecules, Molecular Weight: 1725, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103009-012)
Supplier: Anaspec Inc
Description: Histone H3 (5-23), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2013.3, Sequence: QTARKSTGGKAPRKQLASK, peptide represents amino acid residues 5-23 of histone H3 and used as substrate for histone acetyl-transferase (HAT) assay, Storage: -20 degree C, Size: 1mg


Catalog Number: (103007-368)
Supplier: Anaspec Inc
Description: Delta - Toxin (1 - 26), Staphylococcus aureus, Sequence: MAQDIISTIGDLVKWIIDTVNKFTKK, Purity: By HPLC greater than or equal to 95%, 26-residue hemolytic peptide secreted by Staphylococcus aureus, Molecular Weight: 2978.6, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103008-684)
Supplier: Anaspec Inc
Description: Histone H4 (8-25)-WC, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2278.7, Sequence: KGLGKGGAKRHRKVLRDNWC-NH2, amidated version of Histone H4 residues 8-25. It contains two additional residues (WC) on its C-terminus, Storage: -20 degree C, Size: 1mg


Catalog Number: (103007-478)
Supplier: Anaspec Inc
Description: Deltorphin A, Sequence: YmFHLMD-NH2, Purity: By HPLC >/= 95%, peptide was isolated from skin extracts of the South American frog, Phyllomedusa sauvagei, a potent and selective agonist for the delta-opioid receptor, Molecular Weight: 955.2, Storage: -20 C, Size: 1 mg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
369 - 384 of 147,027
no targeter for Bottom