You Searched For: bra30


13,347  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"13347"
Description: Goat Polyclonal antibody to Cannabinoid Receptor 1 (cannabinoid receptor 1 (brain)) Purity: Antigen affinity chromatography. Species Reactivity: Human Mouse Dog Rat Tested Applications: ELISA WB Pkg Size: 100 ug
Catalog Number: 89297-654
Supplier: Genetex


Description: Polyclonal antibody, Host:Rabbit, Species reactivity:Mouse, Dog, Immunogen:Produced in rabbits immunized with a synthetic peptide corresponding a region of mouse CSNK1G1. Purified by protein A chromatography method. Applications: ELISA, Western Blot, 100ug.
Catalog Number: 10106-818
Supplier: Prosci


Description: Cav2.2, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE, Synonyms: BIII, Brain calcium channel III, Application: IHC, Size: 100 ul
Catalog Number: 103278-310
Supplier: Novus Biologicals


Description: TMEM158 Polyclonal Antibody, Host: Rabbit, Cy7 Conjugated, Emmission: 743nm/767nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: 40 kDa BINP binding protein; 40 kDa BINP-binding protein, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10266-564
Supplier: Bioss


Description: TMEM158 Polyclonal Antibody, Host: Rabbit, Cy5 Conjugated, Emmission: 625, 650nm/670nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: 40 kDa BINP binding protein; 40 kDa BINP-binding protein, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10266-562
Supplier: Bioss


Description: Goat Polyclonal antibody to STX1A / STX1B (syntaxin 1A (brain)) Purity: Antigen affinity chromatography. Species Reactivity: Human Mouse Cow Dog Rat Tested Applications: ELISA WB Pkg Size: 100 ug
Catalog Number: 89297-680
Supplier: Genetex


Description: NPAP1 Polyclonal Antibody, Host: Rabbit, Species reactivity: human, Isotype: IgG, Application: WB, IHC-P, IF, Conjugate: Alexa Fluor 680, Purification: Purified by Protein A. Concentration 1ug/ul, synonyms: NPAP1; NPAP 1; NPAP-1, Size: 100ul
Catalog Number: 76107-924
Supplier: Bioss


Catalog Number: 10356-616
Supplier: Bioss


Catalog Number: 10356-618
Supplier: Bioss


Description: CNR1/CB1 Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Cannabinoid receptor I brain, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10325-516
Supplier: Bioss


Description: MAP1 antibody, Monoclonal, Host: Mouse IgG, Clone number: MP-1, Synonyms: MAP1L/MTAP1A, Reactivity: Mouse, Rat, Immunogen: Rat brain microtubule-associated proteins(MAPs). Application: IHC-P, IHC-F, WB
Catalog Number: 10206-162
Supplier: Boster Biological Technology


Description: 250mg Cyclo(Gly-Pro) has been detected in rat brain. In the passive avoidance test in rats, synthetic cycloprolylglycine showed 76% antiamnesic activity. CAS: 3705-27-9 C7H10N2O2 FW: 154.17
Catalog Number: G-1720.0250BA
Supplier: Bachem Americas


Description: 1G Cyclo(Gly-Pro) has been detected in rat brain. In the passive avoidance test in rats, synthetic cycloprolylglycine showed 76% antiamnesic activity. CAS: 3705-27-9 C7H10N2O2 FW: 154.17
Catalog Number: G-1720.1000BA
Supplier: Bachem Americas


Catalog Number: 10356-608
Supplier: Bioss


Catalog Number: 10356-614
Supplier: Bioss


Catalog Number: 89158-476
Supplier: Enzo Life Sciences


1,521 - 1,536 of 13,347