You Searched For: bra30


13,343  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"13343"
Description: ENDOTHELIN-1 (HUMAN, BOVINE, DOG) 5mg This 21-amino acid peptide from vascular endothelial cells of different mammalian species is one of the most potent vasoconstrictors. ET-1 exerts a wide variety of effects on both vascular and non-vascular (e.g. heart, lung, brain) tissues. Toxic peptides from a snake venom, the sarafotoxins, show structural and functional homology to ET-1. The role of ET-1in clinical hypertension has been reviewed by Dhaun et al. and by Sreenivas and Oparil.
Catalog Number: H-6995.0005BA
Supplier: Bachem Americas


Description: Calcineurin alpha Antibody, Monoclonal, Clone: CC-6 IgG, Host: Mouse, Format: IgG1, Immunogen: produced in mice by repeated immunizations with bovine brain calcineurin, Synonym: CNA2, CNB, CNB1, Protein phosphatase 2B regulatory subunit 1, Application: ELISA, WB, IHC, Pack Size: 100 ug
Catalog Number: 10800-498
Supplier: Rockland Immunochemical


Description: GBX2 Polyclonal Antibody, Host: Rabbit, Cy3 Conjugated, Emmission: 512, 550nm/570, 615nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Gastrulation and brain-specic homeobox protein 2, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10264-642
Supplier: Bioss


Description: RhBDNF, polyclonal antibody, Host: Rabbit, Cross Reactivity: mouse, rat, Synonym: Brain-derived neurotrophic factor, Abrineurin, Application: western blotting, regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS., 100ul
Catalog Number: 10782-580
Supplier: Biosensis


Description: GPBB Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Concentration: 1ug/ul, Application: WB, Immunohistochemistry-P, IF, Conjugate: Alexa Fluor 680, Synonyms: Brain glycogen phosphorylase; Glycogen phosphorylase B, Size: 100ul
Catalog Number: 76109-326
Supplier: Bioss


Description: Beta - Amyloid (11 - 40), Human, Purity: % Peak Area By HPLC >/= 95%, MW: 3151.7, Sequence: (One-Letter Code): EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Post-mortem Alzheimer s diseased brain specimens reveals significant levels of AB (11-40/42), Size: 1 mg
Catalog Number: 103005-822
Supplier: Anaspec Inc


Description: NEUROGLYCAN C Polyclonal Antibody, Host: Rabbit, Cy5 Conjugated, Emmission: 625, 650nm/670nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Acidic leucine rich EGF like domain containing brain protein, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10253-500
Supplier: Bioss


Description: BEGAIN/SAPAP Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: BEGAIN; BEGIN; Brain enriched guanylate kinase associated protein, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10253-792
Supplier: Bioss


Description: 50mg MRFA is used as a calibration standard in mass spectrometry (ESI). Miao et al. studied Pt(II) complexes of the tetrapeptide by mass spectrometric methods.
MRFA has been shown to be a competitive inhibitor of an enkephalin-generating endopeptidase isolated from rat brain. The peptide is a substrate for dipeptidyl peptidase III from human erythrocytes and for snapalysin. CAS: 67368-29-0 C23H37N7O5S FW: 523.66 . Synonym: MRFA
Catalog Number: H-4320.0050BA
Supplier: Bachem Americas


Description: 250mg MRFA is used as a calibration standard in mass spectrometry (ESI). Miao et al. studied Pt(II) complexes of the tetrapeptide by mass spectrometric methods.
MRFA has been shown to be a competitive inhibitor of an enkephalin-generating endopeptidase isolated from rat brain. The peptide is a substrate for dipeptidyl peptidase III from human erythrocytes and for snapalysin. CAS: 67368-29-0 C23H37N7O5S FW: 523.66 . Synonym: MRFA
Catalog Number: H-4320.0250BA
Supplier: Bachem Americas


Description: BEGAIN/SAPAP Polyclonal Antibody, Host: Rabbit, Cy7 Conjugated, Emmission: 743nm/767nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: BEGAIN; BEGIN; Brain enriched guanylate kinase associated protein, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10253-790
Supplier: Bioss


Description: NEUROGLYCAN C Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Acidic leucine rich EGF like domain containing brain protein, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10253-504
Supplier: Bioss


Description: Model metabolic syndrome, 10inch tall, size: 4-1/2inch x2-1/10inch x4inch, Card: 6-1/4inch x8-1/4inch, Base:8-7/8inch x6-1/4in
Catalog Number: 470160-274
Supplier: GPI ANATOMICALS

Small Business Enterprise


Description: BEGAIN/SAPAP Polyclonal Antibody, Host: Rabbit, Cy5 Conjugated, Emmission: 625, 650nm/670nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: BEGAIN; BEGIN; Brain enriched guanylate kinase associated protein, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10253-788
Supplier: Bioss


Description: Precisely constructed with completely interchangeable parts. For use in preparation of tissue homogenates, and more.
Catalog Number: 62400-733
Supplier: DWK Life Sciences (KIMBLE)

Description: Polyclonal, Host: Rabbit, Species reacivity: Human, Immunogen: Produced from sera of rabbits pre-immunized with highly pure (>98%) recombinant hBDNF (human Brain-Derived Neurotrophic Factor), Tested application: ELISA, WB
Catalog Number: 10098-088
Supplier: Prosci


1,329 - 1,344 of 13,343