You Searched For: bra30


11,900  results were found

SearchResultCount:"11900"

Sort Results

List View Easy View (new)

Rate These Search Results

Supplier: CHI Scientific
Description: Kit PrimaCell*5 Rat Brain OptiTDS*5: Tissue Dissociation System, A mixture of collagenase I, collagenase III, collagenase IV, and trypsin.

Catalog Number: (470201-674)
Supplier: Vyaire
Description: Consistently high-quality growth media.

Catalog Number: (95021-492)
Supplier: HiMedia
Description: For the cultivation of fastidious pathogenic bacteria, yeasts, and molds.

Supplier: CHI Scientific
Description: Kit PrimaCell*4 Rat Brain OptiTDS*4: Tissue Dissociation System, A mixture of collagenase I, collagenase III, collagenase IV, and trypsin.

Catalog Number: (10783-992)
Supplier: CHI Scientific
Description: The PrimaCell™ system has been developed for the acquisition and growth of primary cells from a variety of different tissue types. Each PrimaCell™ kit has been optimized for each cell type to produce 4-7 times the number of primary cells obtained from published literature protocols. Each kit comes with 100 ml of tissue washing medium, our optimized tissue dissociation system OptiTDS™, 500 ml of growth medium, and enough growth supplements and serum to add to the supplied medium. Kits that require a Fibroblast control system also come with our FibrOut™ kit (added to the growth medium) which reduces or eliminates Fibroblast growth after 2-3 cell growth cycles.


Catalog Number: (10786-672)
Supplier: CHI Scientific
Description: The PrimaCell™ system has been developed for the acquisition and growth of primary cells from a variety of different tissue types. Each PrimaCell™ kit has been optimized for each cell type to produce 4-7 times the number of primary cells obtained from published literature protocols. Each kit comes with 100 ml of tissue washing medium, our optimized tissue dissociation system OptiTDS™, 500 ml of growth medium, and enough growth supplements and serum to add to the supplied medium. Kits that require a Fibroblast control system also come with our FibrOut™ kit (added to the growth medium) which reduces or eliminates Fibroblast growth after 2-3 cell growth cycles.


Catalog Number: (10784-652)
Supplier: CHI Scientific
Description: The PrimaCell™ system has been developed for the acquisition and growth of primary cells from a variety of different tissue types. Each PrimaCell™ kit has been optimized for each cell type to produce 4-7 times the number of primary cells obtained from published literature protocols. Each kit comes with 100 ml of tissue washing medium, our optimized tissue dissociation system OptiTDS™, 500 ml of growth medium, and enough growth supplements and serum to add to the supplied medium. Kits that require a Fibroblast control system also come with our FibrOut™ kit (added to the growth medium) which reduces or eliminates Fibroblast growth after 2-3 cell growth cycles.


Supplier: CHI Scientific
Description: Kit PrimaCell*3 Rat Brain OptiTDS*3: Tissue Dissociation System, A mixture of collagenase I, collagenase III, collagenase IV, and trypsin.

Catalog Number: (89322-202)
Supplier: Genetex
Description: Protein extract from Human Brain: Thalamus (Depression) Pkg Size: 200 ug


Catalog Number: (10784-022)
Supplier: CHI Scientific
Description: The PrimaCell™ system has been developed for the acquisition and growth of primary cells from a variety of different tissue types. Each PrimaCell™ kit has been optimized for each cell type to produce 4-7 times the number of primary cells obtained from published literature protocols. Each kit comes with 100 ml of tissue washing medium, our optimized tissue dissociation system OptiTDS™, 500 ml of growth medium, and enough growth supplements and serum to add to the supplied medium. Kits that require a Fibroblast control system also come with our FibrOut™ kit (added to the growth medium) which reduces or eliminates Fibroblast growth after 2-3 cell growth cycles.


Catalog Number: (10785-344)
Supplier: CHI Scientific
Description: The PrimaCell™ system has been developed for the acquisition and growth of primary cells from a variety of different tissue types. Each PrimaCell™ kit has been optimized for each cell type to produce 4-7 times the number of primary cells obtained from published literature protocols. Each kit comes with 100 ml of tissue washing medium, our optimized tissue dissociation system OptiTDS™, 500 ml of growth medium, and enough growth supplements and serum to add to the supplied medium. Kits that require a Fibroblast control system also come with our FibrOut™ kit (added to the growth medium) which reduces or eliminates Fibroblast growth after 2-3 cell growth cycles.


Catalog Number: (10784-034)
Supplier: CHI Scientific
Description: The PrimaCell™ system has been developed for the acquisition and growth of primary cells from a variety of different tissue types. Each PrimaCell™ kit has been optimized for each cell type to produce 4-7 times the number of primary cells obtained from published literature protocols. Each kit comes with 100 ml of tissue washing medium, our optimized tissue dissociation system OptiTDS™, 500 ml of growth medium, and enough growth supplements and serum to add to the supplied medium. Kits that require a Fibroblast control system also come with our FibrOut™ kit (added to the growth medium) which reduces or eliminates Fibroblast growth after 2-3 cell growth cycles.


Supplier: CHI Scientific
Description: Kit PrimaCell 5* Mouse Brain OptiTDS*, Tissue Dissociation System, A mixture of collagenase I, collagenase III, collagenase III and collagenase IV.

Supplier: Anaspec Inc
Description: This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (10784-004)
Supplier: CHI Scientific
Description: The PrimaCell™ system has been developed for the acquisition and growth of primary cells from a variety of different tissue types. Each PrimaCell™ kit has been optimized for each cell type to produce 4-7 times the number of primary cells obtained from published literature protocols. Each kit comes with 100 ml of tissue washing medium, our optimized tissue dissociation system OptiTDS™, 500 ml of growth medium, and enough growth supplements and serum to add to the supplied medium. Kits that require a Fibroblast control system also come with our FibrOut™ kit (added to the growth medium) which reduces or eliminates Fibroblast growth after 2-3 cell growth cycles.


Supplier: CHI Scientific
Description: Kit, Primacell* 9 Human Brain OptiTDS*9: Tissue Dissociation System, Stability/Storage: Stable at the room temperature, stored at -20 deg C

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
209 - 224 of 11,900
no targeter for Bottom