Print…

You Searched For: bra30


13,343  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"13343"

Rate These Search Results

Image Unavailable-10429-960

MFSD2A Antibody

Description: MFSD2A Polyclonal Antibody, Host: Rabbit , FITC Conjugated, Emmission: 494nm/518nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: MFSD2A; HMFN0656; PP9177, Application: IF(IHC-P), 100ul
Catalog Number: 10429-960
Supplier: Bioss
Product Image-470119-020

Model for educational purpose, Female Muscular Figure, No Organs

Description: Model for educational purpose, Female Muscular Figure, No Organs
Catalog Number: 470119-020
Supplier: American 3B Scientific
Product Image-10787-046

Human FibrOut* 4

Description: Human FibrOut* 4, for brain, neural, combination of several biochemical compounds and reagents, which prevent overgrowth of fibroblastic and contaminated cells and increase targeted cells growth during primary cell culture, Stable at 4-8 degree C, up to 4 months, 1 ml
Catalog Number: 10787-046
Supplier: CHI Scientific
Product Image-10786-048

Rat FibrOut* 4

Description: Rat FibrOut* 4, for brain, neural 5x1ml, combination of several biochemical compounds and reagents, which prevent overgrowth of fibroblastic and contaminated cells and increase targeted cells growth. Stability, package should be stored at 4-8 degree C, effective upto 4 months
Catalog Number: 10786-048
Supplier: CHI Scientific
Product Image-10787-048

Human FibrOut* 4

Description: Human FibrOut* 4, for brain, neural, combination of several biochemical compounds and reagents, which prevent overgrowth of fibroblastic and contaminated cells and increase targeted cells growth during primary cell culture, Stable at 4-8 degree C, up to 4 months, 5 x 1 ml
Catalog Number: 10787-048
Supplier: CHI Scientific
Product Image-10786-046

Rat FibrOut* 4

Description: Rat FibrOut* 4, for brain, neural 1ml, combination of several biochemical compounds and reagents, which prevent overgrowth of fibroblastic and contaminated cells and increase targeted cells growth. Stability, package should be stored at 4-8 degree C, effective upto 4 months
Catalog Number: 10786-046
Supplier: CHI Scientific
Image Unavailable-76084-010

SYNAPSIN 1 PAB 100ul

Description: SYNAPSIN 1 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Conjugate: Alexa Fluor 750, Immunogen: KLH conjugated synthetic peptide derived from SYNAPSIN 1, Synonyms: Synapsin-1; Brain protein 4.1; Synapsi
Catalog Number: 76084-010
Supplier: Bioss
Image Unavailable-103276-934

HAPLN2 PAB 100UL

Description: HAPLN2, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH, Synonyms: Brain link protein 1brain link protein-1, Application: WB, ICC/IF, IHC, IHC-P, Size: 100UL
Catalog Number: 103276-934
Supplier: Novus Biologicals
Image Unavailable-10486-564

ARHGAP32 Antibody

Description: ARHGAP32 Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat,Cy5.5 Conjugated, Isotype: IgG, Emmission/Excitation: 675nm/694nm, Application: IF(IHC-P), Synonymns: Brain-specic Rho GTPase-activating protein, 100ul
Catalog Number: 10486-564
Supplier: Bioss
Image Unavailable-10247-482

HAPLN2 Antibody

Description: HAPLN2 Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Brain link protein 1; Bral1; Hapln2; HPLN2_HUMAN, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10247-482
Supplier: Bioss
Product Image-470030-086

Deluxe Flexible Spine

Description: Deluxe Flexible Spine
Catalog Number: 470030-086
Supplier: American 3B Scientific
Image Unavailable-10206-114

Calcineurin alpha antibody

Description: Calcineurin alpha antibody, Monoclonal, Host: Mouse IgG1, Clone number: CC-6, Synonyms: CNA2/CNB/CNB1/CALNB1/Protein phosphatase 2B regulatory subunit 1, Reactivity: Bovine, Human, Rat, Immunogen: Bovine brain calcineurin.
Catalog Number: 10206-114
Supplier: Boster Biological Technology
Product Image-10786-004

Mouse FibrOut* 4

Description: Mouse FibrOut* 4, for brain, neural 5x1ml, combination of several biochemical compounds and reagents, which prevent overgrowth of fibroblastic and contaminated cells and increase targeted cells growth. Stability, package should be stored at 4-8 degree C, effective upto 4 months
Catalog Number: 10786-004
Supplier: CHI Scientific
Product Image-10786-002

Mouse FibrOut* 4

Description: Mouse FibrOut* 4, for brain, neural 1ml, combination of several biochemical compounds and reagents, which prevent overgrowth of fibroblastic and contaminated cells and increase targeted cells growth. Stability, package should be stored at 4-8 degree C, effective upto 4 months
Catalog Number: 10786-002
Supplier: CHI Scientific
Image Unavailable-89300-368

MS MAB to GAD65

Description: Mouse Monoclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain 65kDa)) Clone: 144  Purity: Affinity purified  Species Reactivity: Human Mouse Rat Tested Applications: FACS IHC IP WB Pkg Size: 50 ul
Catalog Number: 89300-368
Supplier: Genetex
Image Unavailable-10468-612

BIN3 Antibody

Description: BIN3 Polyclonal Antibody, Host: Rabbit , Cy7 Conjugated, Emmission: 743nm/767nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: bin3; BIN3_HUMAN; Bridging integrator 3; MGC14978., Application: IF(IHC-P), 100ul
Catalog Number: 10468-612
Supplier: Bioss
1,601 - 1,616 of 13,343