Print…

You Searched For: bra20


13,343  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"13343"

Rate These Search Results

Image Unavailable-10786-682

PrimaCell* 10 Human Brain Tissue Preparation Buffer 10, Normal Neuron Cells, 1 x 100 ml

Catalog Number: 10786-682
Supplier: CHI Scientific
Image Unavailable-10784-018

Rat Brain PrimaCell*6: Normal Meningeal Cells Growth Supplements with Serum (for 500 ml medium)set

Catalog Number: 10784-018
Supplier: CHI Scientific
Image Unavailable-10785-654

Supplement

Description: Rat Brain PrimaCell* 5 Normal Cerebral Venous Vascular Smooth Muscle Cells Growth Medium Supplements and serum, (5 x 1.0 ml) - A mixture of EGF, Insulin, Hydrocortisone, Cholera toxin, penicillin, and streptomycin
Catalog Number: 10785-654
Supplier: CHI Scientific
Product Image-99990-830

GFAP

Description: Clone number GA5, This antibody reacts with the 52 kD intermediate filament protein GFAP in brain and spinal cord. It labels some astrocytes and some CNS ependymal cells but not oligodendrocytes or neurons. This antibody does not react with other intermediate filament proteins.
Catalog Number: 99990-830
Supplier: Diagnostic Biosystems
Image Unavailable-10474-114

BEX4 Antibody

Description: BEX4 Polyclonal Antibody, Host: Rabbit , Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: BEXL1; NADE3; BEX1 like 1; brain expressed gene 4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10474-114
Supplier: Bioss
Image Unavailable-10260-358

TMEM59L/BSMAP Antibody

Description: TMEM59L/BSMAP Polyclonal Antibody, Host: Rabbit, Cy5 Conjugated, Emmission: 625, 650nm/670nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: BSMAP; Brain-specic membrane-anchored protein, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10260-358
Supplier: Bioss
Image Unavailable-103231-114

EOMES Polyclonal Antibody 25ug

Description: EOMES, Polyclonal Antibody, Host: Sheep, Species reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived recombinant human EOMES, Synonyms: T-box brain2, TBR2, TBR-2, TBR2eomesodermin homolog, T-brain-2, Application: Western Blot, Immunocytochemistry, Size: 25ug
Catalog Number: 103231-114
Supplier: Novus Biologicals
Image Unavailable-102999-794

Beta - Amyloid (1 - 40) 5 mg

Description: Beta - Amyloid (1 - 40), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9, post-secretory aggregation and deposition in the Alzheimer’s disease brain, Size: 5 mg
Catalog Number: 102999-794
Supplier: Anaspec Inc
Image Unavailable-10783-486

PrimaCell* 10 Mouse Brain Tissue Preparation Buffer 10: Normal Neuron Cells, 1 x 100 ml

Catalog Number: 10783-486
Supplier: CHI Scientific
Product Image-10075-702

Synapsin I Antibody

Description: Polyclonal, Host: Rabbit; Species Reactivity: Human, Rat; Immunogen: Synapsin 1 polyclonal antibody was raised against synapsin I native protein purified from bovine brain; Tested Applications: WB, IF, IP, IHC
Catalog Number: 10075-702
Supplier: Prosci
Image Unavailable-10785-326

Mouse Brain PrimaCell* 11, Normal Olfactory Bulb Ensheathing Cells Growth Medium, 5 x 100 ml

Catalog Number: 10785-326
Supplier: CHI Scientific
Image Unavailable-10785-350

Rat Brain PrimaCell* 10, Normal Olfactory Bulb Ensheathing Cells Growth Medium, 5 x 100 ml

Catalog Number: 10785-350
Supplier: CHI Scientific
Image Unavailable-75908-638

CD90 Monoclonal antibody 500 uL

Description: CD90 Monoclonal antibody, Clone: F15-42-1-5, Host: Mouse, Species reactivity: Human, Monkey, Isotype: IgG1, kappa, Conjugate: purified, Immunogen: Purified human brain Thy1Unigene 644697, Application: Immunofluorescence, Flow cytometry, Size: 500 uL
Catalog Number: 75908-638
Supplier: Biotium
Image Unavailable-75908-684

CD90 Monoclonal antibody 500 uL

Description: CD90 Monoclonal antibody, Clone: F15-42-1-5, Host: Mouse, Species reactivity: Human, Monkey, Isotype: IgG1, kappa, Conjugate: CF647, Immunogen: Purified human brain Thy1Unigene 644697, Application: Immunofluorescence, Flow cytometry, Size: 500 uL
Catalog Number: 75908-684
Supplier: Biotium
Image Unavailable-10785-822

Supplement

Description: Human Brain PrimaCell* 3 Normal Cerebral Artery Vascular Smooth Muscle Cells Growth Medium Supplements and serum, (5 x 1.0 ml) - A mixture of EGF, Insulin, Hydrocortisone, Cholera toxin, penicillin, and streptomycin
Catalog Number: 10785-822
Supplier: CHI Scientific
Image Unavailable-75908-648

CD90 Monoclonal antibody 500 uL

Description: CD90 Monoclonal antibody, Clone: F15-42-1-5, Host: Mouse, Species reactivity: Human, Monkey, Isotype: IgG1, kappa, Conjugate: biotin, Immunogen: Purified human brain Thy1Unigene 644697, Application: Immunofluorescence, Flow cytometry, Size: 500 uL
Catalog Number: 75908-648
Supplier: Biotium
1,041 - 1,056 of 13,343