You Searched For: bra20


11,900  results were found

SearchResultCount:"11900"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (76109-326)
Supplier: Bioss
Description: Glycolysis is an evolutionarily conserved series of ten chemical reactions that utilizes eleven enzymes to concomitantly generate pyruvate and ATP from glucose. fructose kinase-2/fructose 2,6-bisphosphatase (PFK-2) stimulates the synthesis and degradation of fructose 2,6-bisphosphate. Glycogen phosphorylase (also known as GP) is an allosteric enzyme important in carbohydrate metabolism. Its activity is regulated through either noncovalent binding of metabolites or by covalent modification. Glycogen phosphorylase catalyzes the phosphorylation of glycogen to Glc-1-P. There are three genes which encode the brain, liver and muscle forms of glycogen phosphorylase, PYGB, PYGL and PYGM. Because of its fundamental role in the metabolism of glycogen, glycogen phosphorylase has been a target for the design of inhibitory compounds, which could be valuable in the therapeutic treatment of type 2 diabetes mellitus.


Catalog Number: (10253-790)
Supplier: Bioss
Description: BEGAIN is a 593 amino acid protein that localizes to cytoplasm and membrane. BEGAIN interacts with PSD-95 and SAPAP1 and forms a ternary complex and may sustain the structure of the postsynaptic density (PSD). BEGAIN is a novel PSD component associated with the core complex of PSD-95 and SAPAP. Because BEGAIN and SAPAP interact with the same region of PSD-95, BEGAIN and SAPAP may compete for the binding to PSD-95 and cannot interact with PSD-95 simultaneously. The C-terminal region of BEGAIN is involved in the interaction with PSD-95 whereas the N-terminal region has a coiled-coil structure that may interact with other molecules. BEGAIN is specifically expressed in brain and enriched in the PSD fraction. BEGAIN is also expressed in neurons and enriched at synaptic junctions, and is likely involved in the organization of synaptic junction components.


Catalog Number: (76109-328)
Supplier: Bioss
Description: Glycolysis is an evolutionarily conserved series of ten chemical reactions that utilizes eleven enzymes to concomitantly generate pyruvate and ATP from glucose. fructose kinase-2/fructose 2,6-bisphosphatase (PFK-2) stimulates the synthesis and degradation of fructose 2,6-bisphosphate. Glycogen phosphorylase (also known as GP) is an allosteric enzyme important in carbohydrate metabolism. Its activity is regulated through either noncovalent binding of metabolites or by covalent modification. Glycogen phosphorylase catalyzes the phosphorylation of glycogen to Glc-1-P. There are three genes which encode the brain, liver and muscle forms of glycogen phosphorylase, PYGB, PYGL and PYGM. Because of its fundamental role in the metabolism of glycogen, glycogen phosphorylase has been a target for the design of inhibitory compounds, which could be valuable in the therapeutic treatment of type 2 diabetes mellitus.


Catalog Number: (10253-792)
Supplier: Bioss
Description: BEGAIN is a 593 amino acid protein that localizes to cytoplasm and membrane. BEGAIN interacts with PSD-95 and SAPAP1 and forms a ternary complex and may sustain the structure of the postsynaptic density (PSD). BEGAIN is a novel PSD component associated with the core complex of PSD-95 and SAPAP. Because BEGAIN and SAPAP interact with the same region of PSD-95, BEGAIN and SAPAP may compete for the binding to PSD-95 and cannot interact with PSD-95 simultaneously. The C-terminal region of BEGAIN is involved in the interaction with PSD-95 whereas the N-terminal region has a coiled-coil structure that may interact with other molecules. BEGAIN is specifically expressed in brain and enriched in the PSD fraction. BEGAIN is also expressed in neurons and enriched at synaptic junctions, and is likely involved in the organization of synaptic junction components.


Catalog Number: (10800-498)
Supplier: Rockland Immunochemical
Description: Calcineurin, the Ca(2+)/calmodulin-regulated protein phosphatase, first detected in skeletal muscle and brain, has been found in all cells from yeast to mammals. Calcineurin A alpha (PPP3CA),is located on human chromosomes 4, Chromosomal mapping of the human genes for the calmodulin-dependent protein phosphatase (calcineurin) catalytic subunit. Calcineurin regulates bone formation by the osteoblast. This antibody is suitable for researchers interested in apoptosis, transcription factors, nuclear receptors, cancer research, Immune Response, cardiovascular disease, MAK Kinase Signaling, and AKT Signaling.


Catalog Number: (10264-642)
Supplier: Bioss
Description: The isthmic organizer signals at the mid/hindbrain boundary (MHB) regulate the development and differentiation of the vertebrate caudal midbrain and the anterior hindbrain. The MHB forms at the boundary of expression between homeobox genes Gbx2 and Otx2. Gbx2 and Otx2 play distinct, essential roles in MHB positioning and development. During development, the GBX2 gene is expressed in the anterior hindbrain. Specifically, Gbx2 negatively regulates Otx2 expression along the anterior-posterior axis; Gbx2(-) mutants demonstrate an expanded Otx2 domain. During development, the GBX2 gene is expressed in the anterior hindbrain. Gbx2 is expressed in the adult brain, spleen and female genital tract. The GBX2 gene is over-expressed in human prostate cancer cell lines (TSU-prl, PC3, DU145 and LNCaP). Furthermore, downregulation of Gbx2 expression restricts tumorigenicity in human prostate cancer cell lines, which suggests that Gbx2 expression may be required for growth of malignant prostate cells.


Supplier: Bachem Americas
Description: MRFA is used as a calibration standard in mass spectrometry (ESI). Miao et al. studied Pt(II) complexes of the tetrapeptide by mass spectrometric methods. MRFA has been shown to be a competitive inhibitor of an enkephalin-generating endopeptidase isolated from rat brain. The peptide is a substrate for dipeptidyl peptidase III from human erythrocytes and for snapalysin.

Catalog Number: (10782-580)
Supplier: Biosensis
Description: BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. POst translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.


Catalog Number: (103005-822)
Supplier: Anaspec Inc
Description: Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (10253-500)
Supplier: Bioss
Description: Neuroglycan C is a brain-specific chondroitin sulfate proteoglycan (CSPG) implicated in the proliferation of neural stem and progenitor cells. Neuro-glycan C is a single-pass membrane protein that can manifest as a part-time proteoglycan depending on the tissue expressing it. In its proteoglycan form, Neuroglycan C exhibits chondroitin sulfate glycans and functions as a receptor for midkine, a growth factor that binds heparin, to affect cytoskeletal changes. By means of ectodomain shedding, the ectodomain of Neuroglycan C is able to enhance neurite outgrowth from neurons. Neurite growth stimulation is affected by both an EGF-like and an acidic amino acid domain found on the shed ectodomain. Both domains instigate neurite growth, however, these domains exhibit differing functionality as to number of neurites produced and neuron types stimulated.


Catalog Number: (10253-504)
Supplier: Bioss
Description: Neuroglycan C is a brain-specific chondroitin sulfate proteoglycan (CSPG) implicated in the proliferation of neural stem and progenitor cells. Neuro-glycan C is a single-pass membrane protein that can manifest as a part-time proteoglycan depending on the tissue expressing it. In its proteoglycan form, Neuroglycan C exhibits chondroitin sulfate glycans and functions as a receptor for midkine, a growth factor that binds heparin, to affect cytoskeletal changes. By means of ectodomain shedding, the ectodomain of Neuroglycan C is able to enhance neurite outgrowth from neurons. Neurite growth stimulation is affected by both an EGF-like and an acidic amino acid domain found on the shed ectodomain. Both domains instigate neurite growth, however, these domains exhibit differing functionality as to number of neurites produced and neuron types stimulated.


Catalog Number: (10253-788)
Supplier: Bioss
Description: BEGAIN is a 593 amino acid protein that localizes to cytoplasm and membrane. BEGAIN interacts with PSD-95 and SAPAP1 and forms a ternary complex and may sustain the structure of the postsynaptic density (PSD). BEGAIN is a novel PSD component associated with the core complex of PSD-95 and SAPAP. Because BEGAIN and SAPAP interact with the same region of PSD-95, BEGAIN and SAPAP may compete for the binding to PSD-95 and cannot interact with PSD-95 simultaneously. The C-terminal region of BEGAIN is involved in the interaction with PSD-95 whereas the N-terminal region has a coiled-coil structure that may interact with other molecules. BEGAIN is specifically expressed in brain and enriched in the PSD fraction. BEGAIN is also expressed in neurons and enriched at synaptic junctions, and is likely involved in the organization of synaptic junction components.


Catalog Number: (470160-274)
Supplier: GPI ANATOMICALS
Description: This is miniature of brain, heart, kidney, liver, artery, pancreas.

Small Business Enterprise


Catalog Number: (10098-088)
Supplier: Prosci
Description: Brain derived neurotrophic factor (BDNF) is a member of the neurotrophin family of growth factors that includes NGF, NT3, and NT4. All neurotrophins have six conserved cysteine residues and share a 55% sequence identity at the amino acid level. BDNF is a potent neurotrophic factor that supports the growth and survivability of nerve and/or glial cells. BDNF has been shown to enhance the survival and differentiation of several classes of neurons in vitro, including neural crest and placode derived sensory neurons, dopaminergic neurons in the substantia nigra, basal forebrain cholinergic neurons, hippocampal neurons, and retinal ganglial cells. BDNF is expressed within peripheral ganglia and is not restricted to neuronal target fields, raising the possibility that BDNF has paracrine or even autocrine actions on neurons as well as non neuronal cells. Expression of BDNF is reduced in both Alzheimer's and Huntington disease patients. In addition, functional studies showed that age-associated changes in BDNF-mediated pathways can enhance inflammation and increase myocardial injury after myocardial infarction in the aging heart.


Catalog Number: (10253-498)
Supplier: Bioss
Description: Neuroglycan C is a brain-specific chondroitin sulfate proteoglycan (CSPG) implicated in the proliferation of neural stem and progenitor cells. Neuro-glycan C is a single-pass membrane protein that can manifest as a part-time proteoglycan depending on the tissue expressing it. In its proteoglycan form, Neuroglycan C exhibits chondroitin sulfate glycans and functions as a receptor for midkine, a growth factor that binds heparin, to affect cytoskeletal changes. By means of ectodomain shedding, the ectodomain of Neuroglycan C is able to enhance neurite outgrowth from neurons. Neurite growth stimulation is affected by both an EGF-like and an acidic amino acid domain found on the shed ectodomain. Both domains instigate neurite growth, however, these domains exhibit differing functionality as to number of neurites produced and neuron types stimulated.


Catalog Number: (10102-182)
Supplier: Prosci
Description: KLHL1 contains 6 Kelch repeats and 1 BTB (POZ) domain..It is highly expressed in brain. KLHL1 may play a role in organizing the actin cytoskeleton of the brain cells.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
849 - 864 of 11,900
no targeter for Bottom