You Searched For: bra20


11,900  results were found

SearchResultCount:"11900"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (76628-764)
Supplier: LIFE TECHNOLOGIES CORP
Description: Difco Brain heart infusion, without dextrose, is an animal origin (AO) enzymatic digest of bovine and porcine animal proteins.


Catalog Number: (89148-646)
Supplier: Enzo Life Sciences
Description: The major ganglioside of the extra-nervous system. Inhibits growth of epidermal cells.


Supplier: CHI Scientific
Description: Primacell* 3 Kit Human Brain Tissue Dissociation System, Brain OptiTDS* 3, (2 x 1 ml) - A mixture of collagenase I, collagenase III, collagenase IV, and trypsin

Catalog Number: (95029-406)
Supplier: G-Biosciences
Description: G-Biosciences offers a selection of ready-to-screen, human, single tissue blots, from both normal and tumor tissues.


Supplier: TMW Media Group
Description: More advanced topics in science.

Catalog Number: (470183-520)
Supplier: VWR
Description: Organ Systems from Representative Invertebrates and Vertebrates


Catalog Number: (82023-144)
Supplier: G-Biosciences
Description: G-Biosciences offers a selection of ready-to-screen, single tissue (normal) mouse blots.


Catalog Number: (82023-142)
Supplier: G-Biosciences
Description: G-Biosciences offers a selection of ready-to-screen, human, single tissue blots from normal tissues.


Catalog Number: (103006-368)
Supplier: Anaspec Inc
Description: BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (470343-186)
Supplier: BACKYARD BRAINS, INC.
Description: Easier To Use Design!


Catalog Number: (470323-216)
Supplier: BACKYARD BRAINS, INC.
Description: A refill or an accessory!.


Supplier: BACKYARD BRAINS, INC.
Description: Have Extra On Hand!

Catalog Number: (76707-078)
Supplier: AFG BIOSCIENCE LLC
Description: Human Fatty acid-Binding Protein, Brain(FABP7,BLBP,FABPB,MRG) ELISA Kit


Catalog Number: (89138-166)
Supplier: Biotium
Description: is a selective inhibitor for the brain nitric oxide synthase (NOS).


Supplier: Sklar
Description: Sklar® Cushing forceps are light to medium weight thumb forceps used on delicate tissue. They are commonly used in neurosurgery. Cushing forceps have very narrow tips and are useful in small surgical areas.

Catalog Number: (82023-146)
Supplier: G-Biosciences
Description: G-Biosciences offers a selection of ready-to-screen, single tissue (normal) rat blots.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
449 - 464 of 11,900
no targeter for Bottom