Print…

You Searched For: bra20


13,347  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"13347"

Rate These Search Results

Product Image-100492-838

RBM RAT PUP, 30G, SAGITAL

Description: for similar purposes as tissue matrices but for rodent brains, it allows the investigator to slice either coronal (perpendicular to center line) or sagittal (parallel to center line) sections through the brain at 1mm intervals,
Catalog Number: 100492-838
Supplier: Electron Microscopy Sciences

Minority or Woman-Owned Business Enterprise


Product Image-100491-546

RBM MOUSE, 30G, SAGITAL

Description: for similar purposes as tissue matrices but for rodent brains, it allows the investigator to slice either coronal (perpendicular to center line) or sagittal (parallel to center line) sections through the brain at 1mm intervals, a
Catalog Number: 100491-546
Supplier: Electron Microscopy Sciences

Minority or Woman-Owned Business Enterprise


Product Image-100491-548

RBM RAT, 125-185G, CORONAL

Description: for similar purposes as tissue matrices but for rodent brains, it allows the investigator to slice either coronal (perpendicular to center line) or sagittal (parallel to center line) sections through the brain at 1mm intervals
Catalog Number: 100491-548
Supplier: Electron Microscopy Sciences

Minority or Woman-Owned Business Enterprise


Image Unavailable-10786-290

Kit PrimaCell 5* Mouse Brain OptiTDS

Description: Kit PrimaCell 5* Mouse Brain OptiTDS*, Tissue Dissociation System, A mixture of collagenase I, collagenase III, collagenase III and collagenase IV.
Catalog Number: 10786-290
Supplier: CHI Scientific
Image Unavailable-102996-424

BNP-32 1 mg

Description: BNP-32, human, Purity: HPLC >/= to 95%, Molecular Weight: 3464.1, Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, Appearance: Lyophilized white powder, It is also called the brain natriuretic peptide because it was first identified in porcine brain, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-424
Supplier: Anaspec Inc
Product Image-10784-004

Rat Brain PrimaCell*5 kit

Description: Rat Brain PrimaCell*5 Kit for isolation and growth of normal Rat cerebral venous vascular smooth muscle Cells. Contains Rat Brain OptiTDS*5, Rat Brain FIBROUT*5, Rat Brain Growth Medium, Rat Brain Growth Supplements, Rat Brain Tissue Preparation Buffer 5
Catalog Number: 10784-004
Supplier: CHI Scientific
Product Image-100499-560

RBM ADULT CAT, CORONAL

Description: for similar purposes as tissue matrices but for rodent brains, it allows the investigator to slice either coronal (perpendicular to center line) or sagittal (parallel to center line) sections through the brain at 1mm intervals, al
Catalog Number: 100499-560
Supplier: Electron Microscopy Sciences

Minority or Woman-Owned Business Enterprise


Product Image-100492-846

RBM ADULT DOG, CORONAL

Description: for similar purposes as tissue matrices but for rodent brains, it allows the investigator to slice either coronal (perpendicular to center line) or sagittal (parallel to center line) sections through the brain at 1mm intervals, al
Catalog Number: 100492-846
Supplier: Electron Microscopy Sciences

Minority or Woman-Owned Business Enterprise


Image Unavailable-102996-422

BNP-32 0.5 mg

Description: BNP-32, human, Purity: HPLC >/= to 95%, Molecular Weight: 3464.1, Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, Appearance: Lyophilized white powder, It is also called the brain natriuretic peptide because it was first identified in porcine brain, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-422
Supplier: Anaspec Inc
Image Unavailable-10784-654

Primacell* 9 Human Brain OptiTDS*9 kit

Description: Kit, Primacell* 9 Human Brain OptiTDS*9: Tissue Dissociation System, Stability/Storage: Stable at the room temperature, stored at -20 deg C
Catalog Number: 10784-654
Supplier: CHI Scientific
Product Image-10784-034

Rat Brain PrimaCell*8 kit

Description: Rat Brain PrimaCell*8 Kit Normal Nerve Microglia for isolation and growth of normal Rat nerve microglia. Contains Rat Brain OptiTDS*8, Rat Brain FIBROUT*8, Rat Brain Growth Medium, Rat Brain Growth Supplements with Serum, Rat Brain Tissue Preparation Buffer 8
Catalog Number: 10784-034
Supplier: CHI Scientific
Image Unavailable-10784-630

Primacell* 7 Human Brain OptiTDS*7 kit

Description: Primacell* 7 Human Brain OptiTDS*7: Tissue Dissociation System, Stability/Storage: Stable at the room temperature, stored at -20 deg C
Catalog Number: 10784-630
Supplier: CHI Scientific
Image Unavailable-10783-430

Kit PrimaCell* 3 Mouse Brain OptiTDS* 3

Description: Kit PrimaCell* 3 Mouse Brain OptiTDS* 3: Tissue Dissociation System, A mixture ofcollagenase I, collagenase III, collagenase IV, and trypsin.
Catalog Number: 10783-430
Supplier: CHI Scientific
Image Unavailable-10786-644

Kit PrimaCell* 2 Human Brain OptiTDS* 2

Description: Kit PrimaCell* 2 Human Brain OptiTDS* 2, Tissue Dissociation System, Stability, package should be stored at -20 degree C, effective up to 4 months
Catalog Number: 10786-644
Supplier: CHI Scientific
Image Unavailable-10784-024

Kit PrimaCell*7 Rat Brain OptiTDS*7

Description: Kit PrimaCell*7 Rat Brain OptiTDS*7: Tissue Dissociation System, Stability: package should be stored at -20 oC, and effective up to 4 months
Catalog Number: 10784-024
Supplier: CHI Scientific
Image Unavailable-10784-036

Kit PrimaCell*8 Rat Brain OptiTDS*8

Description: Kit PrimaCell*8 Rat Brain OptiTDS*8: Tissue Dissociation System, Stability: package should be stored at -20 oC, and effective up to 4 months
Catalog Number: 10784-036
Supplier: CHI Scientific
337 - 352 of 13,347