Print…

You Searched For: bra20


13,343  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"13343"

Rate These Search Results

Image Unavailable-103003-040

Beta-Amyloid (1-37) 0.5mg

Description: Beta-Amyloid (1-37), Human, Purity: Greater than or equal to 95% (% Peak Area By HPLC), Molecular weight: 4074.6, Sequence: (One-Letter Code) AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG, Storage: At -20 degree C, Size: 0.5mg
Catalog Number: 103003-040
Supplier: Anaspec Inc
Image Unavailable-RL100-401-D71

Mecp2 Phospho S80 Antibody 100

Description: Anti-Mecp2 Ps80 (Rabbit) Antibody - 100-401-D71 Mecp2 Phospho S80 Antibody 100Ul
Catalog Number: RL100-401-D71
Supplier: Rockland Immunochemical
Image Unavailable-77440-544

ANTIBODY PRIMARY BS-14050R 100UL

Catalog Number: 77440-544
Supplier: Bioss
Image Unavailable-102999-788

Beta - Amyloid (1 - 38) 1 mg

Description: Beta - Amyloid (1 - 38), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4131.6, Reconstitute by adding 30-50 ul 1%NH4OH to 0.5 mg B-Amyloid (1-38) peptide, Size: 1 mg
Catalog Number: 102999-788
Supplier: Anaspec Inc
Image Unavailable-10229-026

ACTH 7-23 Antibody

Description: ACTH 7-23 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: MSH; NPP; POC; POMC, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10229-026
Supplier: Bioss
Image Unavailable-10232-306

NNOS/ Antibody

Description: NNOS/ Polyclonal Antibody, Host: Rabbit, Cy7 Conjugated, Emmission: 743nm/767nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: NO; NOS 1; NOS; NOS type I; NOS-I, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10232-306
Supplier: Bioss
Image Unavailable-10338-358

GLYPICAN 4 Antibody

Description: GLYPICAN 4 Polyclonal Antibody, Host: Rabbit, Cy3 Conjugated, Emmission: 512, 550nm/570, 615nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: dJ900E8.1 glypican 4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10338-358
Supplier: Bioss
Image Unavailable-10338-368

GLYPICAN 4 Antibody

Description: GLYPICAN 4 Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: dJ900E8.1 glypican 4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10338-368
Supplier: Bioss
Image Unavailable-10396-692

TM7SF2 Antibody

Description: TM7SF2 Polyclonal Antibody, Host: Rabbit , HRP Conjugated, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ANG1; Another new gene 1 protein, Application: IHC-P, 100ul
Catalog Number: 10396-692
Supplier: Bioss
Image Unavailable-89365-160

Rabbit Polyclonal antibody to OPRM1

Description: Purity: Immunogen affinity purified. Species Reactivity: Human Tested Applications: IHC-P Pkg Size: 25 ug
Catalog Number: 89365-160
Supplier: Genetex
Image Unavailable-10448-998

Mitochondrial Creatine Kinase Antibody

Description: Mitochondrial Creatine Kinase Polyclonal Antibody, Host: Rabbit , FITC Conjugated, Emmission: 494nm/518nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: CKMT; CKMT1; UMTCK, Application: IF(IHC-P), 100ul
Catalog Number: 10448-998
Supplier: Bioss
Image Unavailable-10434-986

Ryanodine Receptor Antibody

Description: Ryanodine Receptor Polyclonal Antibody, Host: Rabbit , ALEXA FLUOR 555 Conjugated, Emmission: 553nm/568nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ARVC 2; ARVC2; ARVD 2, Application: IF(IHC-P), 100ul
Catalog Number: 10434-986
Supplier: Bioss
Image Unavailable-10455-178

LRRC15 Antibody

Description: LRRC15 Polyclonal Antibody, Host: Rabbit , Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: LIB; LRC15_HUMAN, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10455-178
Supplier: Bioss
Image Unavailable-75930-526

Anti-NPAS3 pab 100ug

Description: Anti-NPAS3, Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: Igg, Immunogen: prepared from whole rabbit serum produced by repeated immunizations with a 28 amino acid synthetic peptide, Synonyms: NPAS3, MOP6, PASD6, Application: ELISA, WB, Ihc, If, Size: 100ug
Catalog Number: 75930-526
Supplier: Rockland Immunochemical
Product Image-10093-634

Anti-RGS9

Description: Anti-RGS9 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 273-622 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, Recommended Storage: - 20 C or lower
Catalog Number: 10093-634
Supplier: Proteintech
Image Unavailable-10448-996

Mitochondrial Creatine Kinase Antibody

Description: Mitochondrial Creatine Kinase Polyclonal Antibody, Host: Rabbit , Cy7 Conjugated, Emmission: 743nm/767nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: CKMT; CKMT1; UMTCK, Application: IF(IHC-P), 100ul
Catalog Number: 10448-996
Supplier: Bioss
2,609 - 2,624 of 13,343