Print…

You Searched For: bra20


13,343  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"13343"

Rate These Search Results

Image Unavailable-10402-214

TM7SF2 Antibody

Description: TM7SF2 Polyclonal Antibody, Host: Rabbit , Cy5.5 Conjugated, Emmission: 675nm/694nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ANG1; Another new gene 1 protein, Application: IF(IHC-P), 100ul
Catalog Number: 10402-214
Supplier: Bioss
Image Unavailable-10338-360

GLYPICAN 4 Antibody

Description: GLYPICAN 4 Polyclonal Antibody, Host: Rabbit, Cy5 Conjugated, Emmission: 625, 650nm/670nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: dJ900E8.1 glypican 4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10338-360
Supplier: Bioss
Image Unavailable-10402-210

TM7SF2 Antibody

Description: TM7SF2 Polyclonal Antibody, Host: Rabbit , Cy3 Conjugated, Emmission: 512,550nm/570,615nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ANG1; Another new gene 1 protein, Application: IF(IHC-P), 100ul
Catalog Number: 10402-210
Supplier: Bioss
Image Unavailable-10269-042

SLC5A3/SMIT Antibody

Description: SLC5A3/SMIT Polyclonal Antibody, Host: Rabbit, Cy5 Conjugated, Emmission: 625, 650nm/670nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Na+/myo inositol cotransporter; Na+/myo-inositol cotransporter; SC5A3_HUMAN, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10269-042
Supplier: Bioss
Image Unavailable-76117-202

Ryanodine Receptor Polyclonal Antibody 100ul

Description: Ryanodine Receptor Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species Reactivity: Human, Mouse, Rat, Conjugate: Alexa Fluor 750, Concentration: 1ug/ul, Synonyms: ARVC 2, ARVD 2, Ryanodine receptor 1 skeletal, Application: IHC-P, IF, Size: 100ul
Catalog Number: 76117-202
Supplier: Bioss
Image Unavailable-75930-526

Anti-NPAS3 pab 100ug

Description: Anti-NPAS3, Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: Igg, Immunogen: prepared from whole rabbit serum produced by repeated immunizations with a 28 amino acid synthetic peptide, Synonyms: NPAS3, MOP6, PASD6, Application: ELISA, WB, Ihc, If, Size: 100ug
Catalog Number: 75930-526
Supplier: Rockland Immunochemical
Product Image-75838-768

NGF Rapid* ELISA Kit 2 Plate

Description: NGF Rapid* ELISA Kit, contains 2 x 96 pre-coated strip plate, protein standards, detection reagents, wash and sample buffers and detailed protocols, Specificity: Human, Range: 3.9 - 250 pg/mL, Synonym: Beta-nerve growth factor; Ngfb, Storage: 4 deg C, Size: 2 Plate
Catalog Number: 75838-768
Supplier: Biosensis
Product Image-75838-766

NGF Rapid* ELISA Kit 1 Plate

Description: NGF Rapid* ELISA Kit, contains 1 x 96 pre-coated strip plate, protein standards, detection reagents, wash and sample buffers and detailed protocols, Specificity: Human, Range: 3.9 - 250 pg/mL, Synonym: Beta-nerve growth factor; Ngfb, Storage: 4 deg C, Size: 1 Plate
Catalog Number: 75838-766
Supplier: Biosensis
Image Unavailable-76109-852

HIP12 Polyclonal Antibody 100ul

Description: HIP12 Antibody, Polyclonal, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, Conjugate: Alexa Fluor 750, Synonyms: Hip1 related;HIP12;HIP3;Huntingtin Interacting Protein 1 Related;HIP1R;Huntingtin interacting protein 12;HIP1R_HUMAN, Size: 100ul
Catalog Number: 76109-852
Supplier: Bioss
Product Image-10749-896

NPAS3 antibody

Description: NPAS3 antibody, polyclonal, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: NPAS3 antibody was raised against a 28 amino acid synthetic peptide from near the amino terminus of human NPAS3, Applications:ELISA, IF, IHC, WB
Catalog Number: 10749-896
Supplier: Prosci
Product Image-10102-808

CYP46A1 antibody

Description: Polyclonal, Host: Rabbit, Species reactivity: human mouse rat , Immunogen: produced in rabbits immunized with a synthetic peptide corresponding a region of human CYP46A1. Purified by peptide affinity chromatography method. Application: ELISA Western blot 50ug
Catalog Number: 10102-808
Supplier: Prosci
Image Unavailable-102996-490

Beta-Amyloid (1-38) 0.5 mg

Description: Beta-Amyloid (1-38), Human, Purity: HPLC >/= 95%, Molecular Weight: 4131.6, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-490
Supplier: Anaspec Inc
Image Unavailable-10338-358

GLYPICAN 4 Antibody

Description: GLYPICAN 4 Polyclonal Antibody, Host: Rabbit, Cy3 Conjugated, Emmission: 512, 550nm/570, 615nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: dJ900E8.1 glypican 4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10338-358
Supplier: Bioss
Image Unavailable-10396-692

TM7SF2 Antibody

Description: TM7SF2 Polyclonal Antibody, Host: Rabbit , HRP Conjugated, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ANG1; Another new gene 1 protein, Application: IHC-P, 100ul
Catalog Number: 10396-692
Supplier: Bioss
Image Unavailable-10338-368

GLYPICAN 4 Antibody

Description: GLYPICAN 4 Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: dJ900E8.1 glypican 4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10338-368
Supplier: Bioss
Image Unavailable-76634-862

SYNAPTOPHYSIN

Catalog Number: 76634-862
Supplier: Diagnostic Biosystems
2,593 - 2,608 of 13,343