Print…

You Searched For: bra20


13,343  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"13343"

Rate These Search Results

Image Unavailable-10484-346

BRP44L Antibody

Description: BRP44L Polyclonal Antibody, Host: Rabbit , Cy5 Conjugated, Emmission: 625,650nm/670nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: Apoptosis regulating basic protein; Brain protein 44 like protein, Application: IF(IHC-P), 100ul
Catalog Number: 10484-346
Supplier: Bioss
Image Unavailable-103267-646

GSTM3 Polyclonal antibody 100UL

Description: GSTM3, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Immunogen: developed against Recombinant Protein corresponding to amino acids, Synonyms: glutathione S-transferase mu 3 (brain), GST5Mu-3, Application: WB, IHC, Size: 100UL
Catalog Number: 103267-646
Supplier: Novus Biologicals
Image Unavailable-103270-322

Cav1.3 Polyclonal Antibody 100 UL

Description: Cav1.3, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Reactivity: Human, Immunogen: Developed against Recombinant Protein corresponding to amino acids, Synonyms: CACN4calcium channel, neuroendocrine/brain-type, alpha 1 subunit, Application: IHC, Size: 100 UL
Catalog Number: 103270-322
Supplier: Novus Biologicals
Image Unavailable-103412-360

Aldolase C monoclonal antibody 0.1 ml

Description: Aldolase C, monoclonal antibody, Clone: 1A1, Host: Mouse, Species: Rat, Isotype: IgG1, Conjugate: Biotin, Synonyms: ALDC, aldolase 3, aldolase C, fructose-bisphosphate, Brain-type aldolase, EC 4.1.2.13, Application: WB, ICC/IF, Size: 0.1 ml
Catalog Number: 103412-360
Supplier: Novus Biologicals
Image Unavailable-103412-436

Aldolase C monoclonal antibody 0.1 ml

Description: Aldolase C, monoclonal antibody, Clone: 1A1, Host: Mouse, Species: Rat, Isotype: IgG1, Conjugate: HRP, Synonyms: ALDC, aldolase 3, aldolase C, fructose-bisphosphate, Brain-type aldolase, Application: WB, Purity: Protein G purified, Size: 0.1 ml
Catalog Number: 103412-436
Supplier: Novus Biologicals
Image Unavailable-10244-202

CACNA1B N TYPE Antibody

Description: CACNA1B N TYPE Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Brain calcium channel III; BIII; Calcium channel, L type, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10244-202
Supplier: Bioss
Image Unavailable-103280-724

BRP44L PAB 100UL

Description: BRP44L, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: human, Mouse, Rat, Immunogen: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR, Synonyms: brain protein 44-like proteinbrain protein 44-likeCGI-129, Application: WB, ICC/IF, IHC, IHC-P, Size: 100UL
Catalog Number: 103280-724
Supplier: Novus Biologicals
Image Unavailable-103001-638

Beta-Amyloid (1-40) Quantitative ELISA Kit

Description: SensoLyte* Anti-Mouse/Rat beta-Amyloid (1-40) Quantitative ELISA Kit, Colorimetric, detect peptide in brain lysate, cerebrospinal fluid/plasma, Wells are pre-coated and blocked with proprietary solution, Storage: 2-8 degree C, Size: One 96-well strip plate
Catalog Number: 103001-638
Supplier: Anaspec Inc
Image Unavailable-103412-356

Aldolase C monoclonal antibody 0.1 ml

Description: Aldolase C, monoclonal antibody, Clone: 1A1, Host: Mouse, Species: Rat, Isotype: IgG1, Synonyms: ALDC, aldolase 3, aldolase C, fructose-bisphosphate, Brain-type aldolase, EC 4.1.2.13, Application: WB, Flow, ICC/IF, CyTOF-ready, Size: 0.1 ml
Catalog Number: 103412-356
Supplier: Novus Biologicals
Image Unavailable-10484-352

BRP44L Antibody

Description: BRP44L Polyclonal Antibody, Host: Rabbit , FITC Conjugated, Emmission: 494nm/518nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: Apoptosis regulating basic protein; Brain protein 44 like protein, Application: IF(IHC-P), 100ul
Catalog Number: 10484-352
Supplier: Bioss
Image Unavailable-103001-640

Beta-Amyloid (1-42) Quantitative ELISA Kit

Description: SensoLyte* Anti-Mouse/Rat beta-Amyloid (1-42) Quantitative ELISA Kit, Colorimetric, detect peptide in brain lysate, cerebrospinal fluid/plasma, Wells are pre-coated and blocked with proprietary solution, Storage: 2-8 degree C, Size: One 96-well strip plate
Catalog Number: 103001-640
Supplier: Anaspec Inc
Image Unavailable-102988-410

Ganglioside GD1a disodium salt 1MG

Description: Ganglioside GD1a disodium salt (bovine brain), Purity: >/=98% (TLC), Cas Number: 12707-58-3, Formula: C84H146N4O39. 2Na, Molecular Weight: 1836.1, Appearance: Lyophilized, Soluble in water, Synonyms: GD1a. 2Na, Disialoganglioside GD1a. 2Na, Size: 1MG
Catalog Number: 102988-410
Supplier: Adipogen
Image Unavailable-102988-412

Ganglioside GD1a disodium salt 5MG

Description: Ganglioside GD1a disodium salt (bovine brain), Purity: >/=98% (TLC), Cas Number: 12707-58-3, Formula: C84H146N4O39. 2Na, Molecular Weight: 1836.1, Appearance: Lyophilized, Soluble in water, Synonyms: GD1a. 2Na, Disialoganglioside GD1a. 2Na, Size: 5MG
Catalog Number: 102988-412
Supplier: Adipogen
Image Unavailable-103412-354

Aldolase C monoclonal antibody 0.025 ml

Description: Aldolase C, monoclonal antibody, Clone: 1A1, Host: Mouse, Species: Rat, Isotype: IgG1, Synonyms: ALDC, aldolase 3, aldolase C, fructose-bisphosphate, Brain-type aldolase, EC 4.1.2.13, Application: WB, Flow, ICC/IF, CyTOF-ready, Size: 0.025 ml
Catalog Number: 103412-354
Supplier: Novus Biologicals
Image Unavailable-10484-348

BRP44L Antibody

Description: BRP44L Polyclonal Antibody, Host: Rabbit , Cy5.5 Conjugated, Emmission: 675nm/694nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: Apoptosis regulating basic protein; Brain protein 44 like protein, Application: IF(IHC-P), 100ul
Catalog Number: 10484-348
Supplier: Bioss
Image Unavailable-10167-992

Alpha Adaptin antibody

Description: Alpha Adaptin antibody, Monoclonal, Host: Mouse, Isotype: IgG2a, Species Reactivity: Human, Mouse, Chicken, Pig, Rat, Amphibians, Bovine, Immunogen: Purified bovine brain adaptor complexeSClone: AC1-M11, Synonyms: adaptor-related protein complex 2, alpha 1 subunit.
Catalog Number: 10167-992
Supplier: Genetex
1,745 - 1,760 of 13,343