Print…

You Searched For: bra20


13,347  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"13347"

Rate These Search Results

Image Unavailable-10466-978

NGFRAP1 Antibody

Description: NGFRAP1 Polyclonal Antibody, Host: Rabbit , Cy7 Conjugated, Emmission: 743nm/767nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: BEX3; BEX3_HUMAN; Brain expressed X linked 3 mouse homolog, Application: IF(IHC-P), 100ul
Catalog Number: 10466-978
Supplier: Bioss
Image Unavailable-89306-706

Rabbit Polyclonal antibody to GAD65 (GAD2)

Description: Glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa)) Purity: Antibodies were purified by affinity-chromatography using epitope-specific peptide. Species Reactivity: Human, Mouse, Rat Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89306-706
Supplier: Genetex
Product Image-10101-626

CCK antibody

Description: Polyclonal antibody, Host:Rabbit, Species reactivity:human, Immunogen:Produced in rabbits immunized with a synthetic peptide corresponding a region of human CCK. Purified by peptide affinity chromatography method. Applications: ELISA, Western Blot, 50ug.
Catalog Number: 10101-626
Supplier: Prosci
Image Unavailable-10019-124

Antibody

Description: CD172a (SIRPA), monoclonal antibody, Clone: P84, Host: Rat, Species Reactivity: Mouse, Isotype: IgG1, Kappa, Immunogen: Mouse brain membrane protein, Conjugate: PE/Dazzle 594, Application: Flow Cytometry, Size: 25ug
Catalog Number: 10019-124
Supplier: Biolegend
Image Unavailable-PAV4168

MET (M1250T) KINASE ENZYME SYStem

Description: Recombinant human MET (point mutant M1250T; amino acids 956–end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. MET is widely expressed in the kidney brain lung skin and embryonic tissue.
Catalog Number: PAV4168
Supplier: Promega Corporation
Product Image-76073-434

LMTK2 polyclonal antibody 400ul

Description: LMTK2, polyclonal antibody, Host: Rabbit, Species: Human, Isotype: Ig, Immunogen: synthetic peptide between 70-100 amino acids from the N-terminal region, Synonyms: Apoptosis-associated tyrosine kinase 2, Brain-enriched ki
Catalog Number: 76073-434
Supplier: Prosci
Image Unavailable-103276-934

HAPLN2 PAB 100UL

Description: HAPLN2, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH, Synonyms: Brain link protein 1brain link protein-1, Application: WB, ICC/IF, IHC, IHC-P, Size: 100UL
Catalog Number: 103276-934
Supplier: Novus Biologicals
Image Unavailable-10486-568

ARHGAP32 Antibody

Description: ARHGAP32 Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat,FITC Conjugated, Isotype: IgG, Emmission/Excitation: 494nm/518nm, Application: IF(IHC-P), Synonymns: Brain-specic Rho GTPase-activating protein, 100ul
Catalog Number: 10486-568
Supplier: Bioss
Image Unavailable-10486-566

ARHGAP32 Antibody

Description: ARHGAP32 Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat,Cy7 Conjugated, Isotype: IgG, Emmission/Excitation: 743nm/767nm, Application: IF(IHC-P), Synonymns: Brain-specic Rho GTPase-activating protein, 100ul
Catalog Number: 10486-566
Supplier: Bioss
Image Unavailable-103286-140

PNMA3 Polyclonal antibody 100ul

Description: PNMA3, Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: IGG Purity: Immunogen affinity purified, Synonyms: MGC132758, paraneoplastic antigen MA3, paraneoplastic cancer-testis-brain antigen, Applications: IHC-P, Size: 100ul
Catalog Number: 103286-140
Supplier: Novus Biologicals
Image Unavailable-10326-314

CNR1/CB1 Antibody

Description: CNR1/CB1 Polyclonal Antibody, Host: Rabbit, Cy3 Conjugated, Emmission: 512, 550nm/570, 615nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Cannabinoid receptor I brain, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10326-314
Supplier: Bioss
Image Unavailable-10743-726

UCHL1 antibody

Description: UCHL1 monoclonal antibody, clone SPM574, Host: Mouse, Species: Bovine, Human, Mouse, Pig, Rat, Isotype: IgG1 Kappa, Immunogen: Native purified human UCHL1 from brain. Application: Wb, Ihc, Size: 100 ug
Catalog Number: 10743-726
Supplier: Abnova
Product Image-10107-470

OTX1 Antibody

Description: Polyclonal, Host: Rabbit, Species: Human, Mouse, Rat, Canine, Immunogen: Produced in rabbits immunized with a synthetic peptide corresponding a region of human OTX1, Applications: ELISA, WB, 100ug
Catalog Number: 10107-470
Supplier: Prosci
Product Image-470119-020

Model for educational purpose, Female Muscular Figure, No Organs

Description: Model for educational purpose, Female Muscular Figure, No Organs
Catalog Number: 470119-020
Supplier: American 3B Scientific
Product Image-10787-048

Human FibrOut* 4

Description: Human FibrOut* 4, for brain, neural, combination of several biochemical compounds and reagents, which prevent overgrowth of fibroblastic and contaminated cells and increase targeted cells growth during primary cell culture, Stable at 4-8 degree C, up to 4 months, 5 x 1 ml
Catalog Number: 10787-048
Supplier: CHI Scientific
Product Image-10786-046

Rat FibrOut* 4

Description: Rat FibrOut* 4, for brain, neural 1ml, combination of several biochemical compounds and reagents, which prevent overgrowth of fibroblastic and contaminated cells and increase targeted cells growth. Stability, package should be stored at 4-8 degree C, effective upto 4 months
Catalog Number: 10786-046
Supplier: CHI Scientific
1,585 - 1,600 of 13,347