You Searched For: b443


741  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"741"
Description: 2-Amino-3,5-dimethylbenzoic acid, Purity: 97%, CAS Number: 14438-32-5, Appearance: Form: Crystal - Powder/Colour: White - Reddish yellow, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1g
Catalog Number: 77273-086
Supplier: AMBEED, INC


Description: 2-Amino-3,5-dimethylbenzoic acid, Purity: 97%, CAS Number: 14438-32-5, Appearance: Form: Crystal - Powder/Colour: White - Reddish yellow, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 5g
Catalog Number: 77273-088
Supplier: AMBEED, INC


Description: Chloro(triphenylphosphine)gold(I), Purity: 98+%, CAS Number: 14243-64-2, Appearance: Form: Crystal - Powder / Colour: White - Very pale yellow, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 100MG
Catalog Number: 76679-810
Supplier: AMBEED, INC


Description: Chloro(triphenylphosphine)gold(I), Purity: 98+%, CAS Number: 14243-64-2, Appearance: Form: Crystal - Powder / Colour: White - Very pale yellow, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 250MG
Catalog Number: 76679-816
Supplier: AMBEED, INC


Description: Chloro(triphenylphosphine)gold(I), Purity: 98+%, CAS Number: 14243-64-2, Appearance: Form: Crystal - Powder / Colour: White - Very pale yellow, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 10G
Catalog Number: 76679-812
Supplier: AMBEED, INC


Description: Chloro(triphenylphosphine)gold(I), Purity: 98+%, CAS Number: 14243-64-2, Appearance: Form: Crystal - Powder / Colour: White - Very pale yellow, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 5G
Catalog Number: 76679-818
Supplier: AMBEED, INC


Description: Shipper, 375 2-8 Summer; Duration: 96 Hours, Payload Volume: 239 Liters, Payload Space - Length: 670 mm, Payload Space - Width: 500 mm, Payload Space - Height: 715 mm, System Weight: 104.3 lbs.
Catalog Number: 76441-522
Supplier: DGP INTELSIUS LLC


Description: 14-3-3 zeta Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ). Alternative Names: YWHAZ, 1433 zeta, Applications: WB, Size: 100ug/vial
Catalog Number: 76464-162
Supplier: Boster Biological Technology


Description: 14-3-3 zeta/delta/YWHAZ Monoclonal Antibody, Clone: 6H7, Host: Mouse, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ), Alternative Names: YWHAZ, 1433 zeta, Size: 100ug/vial
Catalog Number: 76467-738
Supplier: Boster Biological Technology


Description: (2-Trifluoromethyl)phenylboronic acid, Purity: 95%, CAS Number: 1423-27-4, Appearance: Form: Crystal - Powder / Colour: White - Very pale yellow - Yellow, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 100g
Catalog Number: 77137-484
Supplier: AMBEED, INC


Description: (2-Trifluoromethyl)phenylboronic acid, Purity: 95%, CAS Number: 1423-27-4, Appearance: Form: Crystal - Powder / Colour: White - Very pale yellow - Yellow, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 5g
Catalog Number: 77137-494
Supplier: AMBEED, INC


Description: (2-Trifluoromethyl)phenylboronic acid, Purity: 95%, CAS Number: 1423-27-4, Appearance: Form: Crystal - Powder / Colour: White - Very pale yellow - Yellow, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 10g
Catalog Number: 77137-486
Supplier: AMBEED, INC


Description: (2-Trifluoromethyl)phenylboronic acid, Purity: 95%, CAS Number: 1423-27-4, Appearance: Form: Crystal - Powder / Colour: White - Very pale yellow - Yellow, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 500g
Catalog Number: 77137-492
Supplier: AMBEED, INC


Description: (2-Trifluoromethyl)phenylboronic acid, Purity: 95%, CAS Number: 1423-27-4, Appearance: Form: Crystal - Powder / Colour: White - Very pale yellow - Yellow, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 25g
Catalog Number: 77137-490
Supplier: AMBEED, INC


Description: (2-Trifluoromethyl)phenylboronic acid, Purity: 95%, CAS Number: 1423-27-4, Appearance: Form: Crystal - Powder / Colour: White - Very pale yellow - Yellow, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 1g
Catalog Number: 77137-488
Supplier: AMBEED, INC


Description: 14-3-3 zeta/delta/YWHAZ Monoclonal Antibody, Clone: 6G5, Host: Mouse, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ), Alternative Names: YWHAZ, 1433 zeta, Size: 100ug/vial
Catalog Number: 76467-736
Supplier: Boster Biological Technology