You Searched For: b443


582  results were found

SearchResultCount:"582"

Sort Results

List View Easy View (new)

Rate These Search Results

Supplier: AMBEED, INC
Description: Chloro(triphenylphosphine)gold(I), Purity: 98+%, CAS Number: 14243-64-2, Appearance: Form: Crystal - Powder / Colour: White - Very pale yellow, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 10G

Catalog Number: (76441-522)
Supplier: DGP INTELSIUS LLC
Description: The Intelsius® Pharmatherm pallet shipping systems are designed to offer optimal thermal protection for pharmaceutical products.


Catalog Number: (76464-162)
Supplier: Boster Biological Technology
Description: 14-3-3 zeta Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ). Alternative Names: YWHAZ, 1433 zeta, Applications: WB, Size: 100ug/vial


Catalog Number: (76467-738)
Supplier: Boster Biological Technology
Description: 14-3-3 zeta/delta/YWHAZ Monoclonal Antibody, Clone: 6H7, Host: Mouse, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ), Alternative Names: YWHAZ, 1433 zeta, Size: 100ug/vial


Supplier: AMBEED, INC
Description: (2-Trifluoromethyl)phenylboronic acid, Purity: 95%, CAS Number: 1423-27-4, Appearance: Form: Crystal - Powder / Colour: White - Very pale yellow - Yellow, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 100g

Catalog Number: (76467-736)
Supplier: Boster Biological Technology
Description: 14-3-3 zeta/delta/YWHAZ Monoclonal Antibody, Clone: 6G5, Host: Mouse, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ), Alternative Names: YWHAZ, 1433 zeta, Size: 100ug/vial


Catalog Number: (76465-394)
Supplier: Boster Biological Technology
Description: Glycine decarboxylase Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived Glycine decarboxylase/GLDC recombinant protein (Position: K574-S1020), Alternative Names: GLDC, EC 1.4.4.2, GCE, GCSPMGC138198, Glycine cleavage system P protein, Size: 100ug/vial


Catalog Number: (76484-944)
Supplier: AAT BIOQUEST INC
Description: In vivo fluorescence imaging uses a sensitive camera to detect fluorescence emission from fluorophores in whole-body living small animals.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Supplier: ACROBIOSYSTEMS
Description: Human TOP2A/TOP2 Protein, Tag Free, Source: expressed from E.coli cells. It contains AA Ser 1354 - Ser 1473, Predicted N-terminus: Met, protein carries no tag, Synonyms: TOP2A, TOP2, DNA topoisomerase 2-alpha, DNA topoisomerase II, alpha isozyme, Size: 20uG

Catalog Number: (76520-342)
Supplier: Brady Worldwide
Description: Nylon cloth (B-499) wrap-around labels are highly pliable to conform to tightly curved surfaces such as wire and cable.


Supplier: AMBEED, INC
Description: 1-((2R,3R,4S,5R)-3,4-Dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)-5-methylpyrimidine-2,4(1H,3H)-dione, Purity: 97%, CAS Number: 1463-10-1, Appearance: Form: Crystal - Powder/Colour: White - Off white, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 100g

Catalog Number: (76518-594)
Supplier: GILSON, INC.
Description: TRILUTION® micro Software manages your automated PIPETMAX® workflows, allowing you to focus on more important tasks.


Catalog Number: (103824-996)
Supplier: Sino Biological
Description: A DNA sequence encoding the human coronavirus HKU1 (isolate N5) (HCoV-HKU1) spike protein (S1+S2 ECD) (Q0ZME7.1) (Met1-Pro1295) was expressed with a polyhistidine tag at the C-terminus.


Catalog Number: (ALB102162-25G)
Supplier: ALADDIN SCIENTIFIC
Description: -BROMOCINNAMALDEHYDE 5443-49-2 25G

New Product


Catalog Number: (ALB102162-100G)
Supplier: ALADDIN SCIENTIFIC
Description: -BROMOCINNAMALDEHYDE 5443-49-2 100G

New Product


Catalog Number: (ALB102162-5G)
Supplier: ALADDIN SCIENTIFIC
Description: -BROMOCINNAMALDEHYDE 5443-49-2 5G

New Product


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
289 - 304 of 582
no targeter for Bottom