Print…

You Searched For: b430


1,514  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"1514"

Rate These Search Results

Product Image-76484-448

Buccutite/Trade Rap 1340, PE-Cy5 is a popular color used in flow cytometry. Its primary absorption peak is at 565 nm with emission peak at 674 nm. The filter sets of 682/33 nm and 695/40 nm are recommended for this tandem color.

Description: Buccutite/Trade Rap 1340, PE-Cy5 is a popular color used in flow cytometry. Its primary absorption peak is at 565 nm with emission peak at 674 nm. The filter sets of 682/33 nm and 695/40 nm are recommended for this tandem color.
Catalog Number: 76484-448
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76449-584

DXH 500 Hematology Analyzer, 100-240V, Open vial sampling, 60 samples per hour, 12 uL of venous or micro-collected whole blood, 20 uL of whole blood for pre-dilute analysis, Touch screen, Handheld barcode reader, 700 - 1,060 mbar, Depth: 430 mm, Width: 270 mm, Height: 406 mm

Description: DXH 500 Hematology Analyzer, 100-240V, Open vial sampling, 60 samples per hour, 12 uL of venous or micro-collected whole blood, 20 uL of whole blood for pre-dilute analysis, Touch screen, Handheld barcode reader, 700 - 1,060 mbar, Depth: 430 mm, Width: 270 mm, Height: 406 mm
Catalog Number: 76449-584
Supplier: Beckman Coulter
Image Unavailable-76467-738

14-3-3 zeta/delta/YWHAZ Monoclonal Antibody, Clone: 6H7, Host: Mouse, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ), Alternative Names: YWHAZ, 1433 zeta, Size: 100ug/vial

Description: 14-3-3 zeta/delta/YWHAZ Monoclonal Antibody, Clone: 6H7, Host: Mouse, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ), Alternative Names: YWHAZ, 1433 zeta, Size: 100ug/vial
Catalog Number: 76467-738
Supplier: Boster Biological Technology
Product Image-76461-906

Label, Clear, Polyester (B-522), Finish: Semi-gloss, For 3in Core Printers, Heat Resistant, Removable, excellent low temperature resistance, Not recommended for long-term outdoor use, Abrasion-Resistant, Chemical-Resistant, Shape: Rectangle, Thickness: 0.0029 in, Size: 0.437 X 0.5in

Description: Label, Clear, Polyester (B-522), Finish: Semi-gloss, For 3in Core Printers, Heat Resistant, Removable, excellent low temperature resistance, Not recommended for long-term outdoor use, Abrasion-Resistant, Chemical-Resistant, Shape: Rectangle, Thickness: 0.0029 in, Size: 0.437 X 0.5in
Catalog Number: 76461-906
Supplier: Brady Worldwide
Product Image-76461-920

Label, Clear, Polypropylene (B-521), Finish: Semi-gloss, For 3in Core Printers, Heat Resistant, Removable, excellent low temperature resistance, Not recommended for long-term outdoor use, Abrasion-Resistant, Chemical-Resistant, Shape: Rectangle, Thickness: 0.0029 in, Size: 0.437 X 0.5in

Description: Label, Clear, Polypropylene (B-521), Finish: Semi-gloss, For 3in Core Printers, Heat Resistant, Removable, excellent low temperature resistance, Not recommended for long-term outdoor use, Abrasion-Resistant, Chemical-Resistant, Shape: Rectangle, Thickness: 0.0029 in, Size: 0.437 X 0.5in
Catalog Number: 76461-920
Supplier: Brady Worldwide
Image Unavailable-76467-736

14-3-3 zeta/delta/YWHAZ Monoclonal Antibody, Clone: 6G5, Host: Mouse, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ), Alternative Names: YWHAZ, 1433 zeta, Size: 100ug/vial

Description: 14-3-3 zeta/delta/YWHAZ Monoclonal Antibody, Clone: 6G5, Host: Mouse, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ), Alternative Names: YWHAZ, 1433 zeta, Size: 100ug/vial
Catalog Number: 76467-736
Supplier: Boster Biological Technology
Product Image-76484-944

Ifluor/Trade 840 Su 1403 1Mg, In vivo fluorescence imaging a sensitive camera to detect fluorescence emission from fluorophores in whole-body living small animals. To overcome photon attenuation in living tissue, fluorophores with long emission at infrared (IR) region generally preferred, Size: 1mg

Description: Ifluor/Trade 840 Su 1403 1Mg, In vivo fluorescence imaging a sensitive camera to detect fluorescence emission from fluorophores in whole-body living small animals. To overcome photon attenuation in living tissue, fluorophores with long emission at infrared (IR) region generally preferred, Size: 1mg
Catalog Number: 76484-944
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-77159-612

Orcein (from synthetic), Purity: (Synthetic)(Drying loss:max. 25.0 %)(Absorbance(E1%1cm)min. 300(MeOH, 579.0 to 583.0 nm)), CAS Number: 1400-62-0, Appearance: Red to Dark blue to Black powder to crystal, Storage: Sealed in dry, Room Temperature, Size: 100mg

Description: Orcein (from synthetic), Purity: (Synthetic)(Drying loss:max. 25.0 %)(Absorbance(E1%1cm)min. 300(MeOH, 579.0 to 583.0 nm)), CAS Number: 1400-62-0, Appearance: Red to Dark blue to Black powder to crystal, Storage: Sealed in dry, Room Temperature, Size: 100mg
Catalog Number: 77159-612
Supplier: AMBEED, INC
Image Unavailable-77159-614

Orcein (from synthetic), Purity: (Synthetic)(Drying loss:max. 25.0 %)(Absorbance(E1%1cm)min. 300(MeOH, 579.0 to 583.0 nm)), CAS Number: 1400-62-0, Appearance: Red to Dark blue to Black powder to crystal, Storage: Sealed in dry, Room Temperature, Size: 1mg

Description: Orcein (from synthetic), Purity: (Synthetic)(Drying loss:max. 25.0 %)(Absorbance(E1%1cm)min. 300(MeOH, 579.0 to 583.0 nm)), CAS Number: 1400-62-0, Appearance: Red to Dark blue to Black powder to crystal, Storage: Sealed in dry, Room Temperature, Size: 1mg
Catalog Number: 77159-614
Supplier: AMBEED, INC
Product Image-76518-266

Benchtop Meter for Easily Measuring pH and ORP, AB23PH-F, Measurement Range: 0 - 100 deg C;0.00 - 14.00 pH;-1999 - 1999 Mv, Measurement Resolution: 0.1 deg C;0.01 pH;1 mV, Display: LCD with backlight, 5 inch segment LCD with backlight, AC adapter, ABS housing, Dimension: 8.3x2x5.6in

Description: Benchtop Meter for Easily Measuring pH and ORP, AB23PH-F, Measurement Range: 0 - 100 deg C;0.00 - 14.00 pH;-1999 - 1999 Mv, Measurement Resolution: 0.1 deg C;0.01 pH;1 mV, Display: LCD with backlight, 5 inch segment LCD with backlight, AC adapter, ABS housing, Dimension: 8.3x2x5.6in
Catalog Number: 76518-266
Supplier: Ohaus
Product Image-76518-264

Benchtop Meter for Easily Measuring pH and ORP, AB23PH-B, Measurement Range: 0 - 100 deg C;0.00 - 14.00 pH;-1999 - 1999 Mv, Measurement Resolution: 0.1 deg C;0.01 pH;1 mV, Display: LCD with backlight, 5 inch segment LCD with backlight, AC adapter, ABS housing, Dimension: 8.3x2x5.6in

Description: Benchtop Meter for Easily Measuring pH and ORP, AB23PH-B, Measurement Range: 0 - 100 deg C;0.00 - 14.00 pH;-1999 - 1999 Mv, Measurement Resolution: 0.1 deg C;0.01 pH;1 mV, Display: LCD with backlight, 5 inch segment LCD with backlight, AC adapter, ABS housing, Dimension: 8.3x2x5.6in
Catalog Number: 76518-264
Supplier: Ohaus
Image Unavailable-76493-026

Column oven, Tall, High capacity, high precision, Control system Peltier block cooling/heating with air circulation, Temperature setting range: 4-90 deg, Tool-less universal fitting Moment-Enhancing Mechanism (MEM) column fitting max. Pressure: 1400 bar

Description: Column oven, Tall, High capacity, high precision, Control system Peltier block cooling/heating with air circulation, Temperature setting range: 4-90 deg, Tool-less universal fitting Moment-Enhancing Mechanism (MEM) column fitting max. Pressure: 1400 bar
Catalog Number: 76493-026
Supplier: HITACHI HIGH-TECH AMERICA, INC.
Image Unavailable-77234-528

(1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-((E)-1-(2-methylthiazol-4-yl)prop-1-en-2-yl)-17-oxa-4-azabicyclo[14.1.0]heptadecane-5,9-dione, Purity: 98%, CAS Number: 219989-84-1, Appearance: White to off-white solid, Storage: Sealed in dry, Room Temperature, Size: 1mg

Description: (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-((E)-1-(2-methylthiazol-4-yl)prop-1-en-2-yl)-17-oxa-4-azabicyclo[14.1.0]heptadecane-5,9-dione, Purity: 98%, CAS Number: 219989-84-1, Appearance: White to off-white solid, Storage: Sealed in dry, Room Temperature, Size: 1mg
Catalog Number: 77234-528
Supplier: AMBEED, INC
Image Unavailable-77234-530

(1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-((E)-1-(2-methylthiazol-4-yl)prop-1-en-2-yl)-17-oxa-4-azabicyclo[14.1.0]heptadecane-5,9-dione, Purity: 98%, CAS Number: 219989-84-1, Appearance: White to off-white solid, Storage: Sealed in dry, Room Temperature, Size: 5mg

Description: (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-((E)-1-(2-methylthiazol-4-yl)prop-1-en-2-yl)-17-oxa-4-azabicyclo[14.1.0]heptadecane-5,9-dione, Purity: 98%, CAS Number: 219989-84-1, Appearance: White to off-white solid, Storage: Sealed in dry, Room Temperature, Size: 5mg
Catalog Number: 77234-530
Supplier: AMBEED, INC
Image Unavailable-000000000000385752

PAR-0130 - STERILE

Catalog Number: 000000000000385752
Supplier: AVANTOR FLUID HANDLING, LLC

New Product


Image Unavailable-MFLX00403-VL

PUMP UNIT IPC 12 1.4301

Catalog Number: MFLX00403-VL
Supplier: MASTERFLEX LLC
1,265 - 1,280 of 1,514