Print…

You Searched For: b40


15,186  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"15186"

Rate These Search Results

Image Unavailable-TCB0448-500ML

, 100-85-6, C10H17NO, 167.25

Description: , 100-85-6, C10H17NO, 167.25
Catalog Number: TCB0448-500ML
Supplier: TCI America

SDS Certificates


Image Unavailable-102997-266

Human Beta-Amyloid (2-40)

Description: Human Beta-Amyloid (2-40)
Catalog Number: 102997-266
Supplier: Anaspec Inc
Image Unavailable-PAU1191

DUTP

Catalog Number: PAU1191
Supplier: Promega Corporation

Certificates


Image Unavailable-102999-806

Scrambled - beta - Amyloid (1 - 40) 1 mg

Description: Scrambled - beta - Amyloid (1 - 40), human, Sequence: AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9, Apperance: Lyophilized white powder, freely soluble in basic buffer, Size: 1 mg
Catalog Number: 102999-806
Supplier: Anaspec Inc
Image Unavailable-100204-480

Tetrabutylammonium hydroxide,40% in water

Description: CAS #: 2052-49-5. Size: 100g.
Catalog Number: 100204-480
Supplier: Strem Chemicals Inc
Image Unavailable-100204-812

Tetrabutylammonium hydroxide,40% in water

Description: CAS #: 2052-49-5. Size: 25g.
Catalog Number: 100204-812
Supplier: Strem Chemicals Inc
Image Unavailable-TCB0448-25ML

Benzyltrimethylammonium Hydroxide (40% In Methanol)

Description: 25ML, 100-85-6, C10H17NO, 167.25
Catalog Number: TCB0448-25ML
Supplier: TCI America

SDS Certificates


Image Unavailable-TCT1565-25G

Tetrapropylammonium Hydroxide (Ca. 40% In Water)

Description: 25g, 4499-86-9, C12H29NO, 203.37
Catalog Number: TCT1565-25G
Supplier: TCI America

SDS Certificates


Image Unavailable-77428-752

FLUORINERTR(FC-40) 250G

Catalog Number: 77428-752
Supplier: APOLLO SCIENTIFIC
Image Unavailable-102999-804

Human Beta-Amyloid (1-40)

Description: Human Beta-Amyloid (1-40)
Catalog Number: 102999-804
Supplier: Anaspec Inc
Image Unavailable-TCB0448-100ML

Benzyltrimethylammonium Hydroxide (40% In Methanol)

Description: Benzyltrimethylammonium Hydroxide (40% In Methanol), Cas Number: 100-85-6, Molecular Formula: C10H17NO, Molecular Weight:  167.25, Size: 100ML, 100-85-6, C10H17NO, 167.25
Catalog Number: TCB0448-100ML
Supplier: TCI America

SDS Certificates


Image Unavailable-76051-612

VWR* Upright Eco- Freezer Rack 679 x 241 x 140 mm

Description: VWR* Upright Eco- Freezer Rack, Material: Stainless Steel, Box capacity: 5 deep & 3 high configuration 15), To hold 3in boxes, Outside Dimension: 679 x 241 x 140 mm
Catalog Number: 76051-612
Supplier: VWR International
Image Unavailable-76051-610

VWR* Upright Eco- Freezer Rack 679 x 168 x 140 mm

Description: VWR* Upright Eco- Freezer Rack, Material: Stainless Steel, Box capacity: 5 deep & 2 high configuration 10), To hold 3in boxes, Outside Dimension: 679 x 168 x 140 mm
Catalog Number: 76051-610
Supplier: VWR International
Product Image-76447-172

Topmixer 200 System Package, Includes TopMixer 200 Frame, Advanced trolley with loadcells, mixing impeller and 3 containers (50, 100 and 200L).

Description: Topmixer 200 System Package, Includes TopMixer 200 Frame, Advanced trolley with loadcells, mixing impeller and 3 containers (50, 100 and 200L).
Catalog Number: 76447-172
Supplier: JM Separations, VWR Bioprocessing Division

Irregular Voltage


Product Image-76447-174

Topmixer 500 System Package, Includes TopMixer 500 Frame, Advanced trolley with loadcells, mixing impeller and 3 containers (50, 100 and 200L).

Description: Topmixer 500 System Package, Includes TopMixer 500 Frame, Advanced trolley with loadcells, mixing impeller and 3 containers (50, 100 and 200L).
Catalog Number: 76447-174
Supplier: JM Separations, VWR Bioprocessing Division

Irregular Voltage


Image Unavailable-ABCA_AB133040-1X96

ELISA KIT LEUKOTRIEN AB133040-1X96TESTS

Catalog Number: ABCA_AB133040-1X96
Supplier: ABCAM INC.

New Product


1,953 - 1,968 of 15,186