Print…

You Searched For: b40


15,186  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"15186"

Rate These Search Results

Image Unavailable-EM8.16003.0500

Tween 40 For Synthesis

Catalog Number: EM8.16003.0500
Supplier: MilliporeSigma

SDS


Image Unavailable-102111-334

Cyclophilin 40 Antibody

Catalog Number: 102111-334
Supplier: Novus Biologicals
Product Image-10244-692

CONNEXIN-40 Antibody

Description: CONNEXIN-40 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Dog, Isotype: IgG, Synonymns: CX4; ATFB11; Gap junction alpha-5 protein; Connexin-4; GJA5, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10244-692
Supplier: Bioss
Image Unavailable-89317-272

Mouse Monoclonal antibody to Leukotriene B4 (leukotriene B4 receptor)

Description: Clone: 202/7B1 Conjugation: FITC Purity: Protein G purified Species Reactivity: Human Tested Applications: FACS, IHC-Fr Pkg Size: 50 ug
Catalog Number: 89317-272
Supplier: Genetex
Product Image-14205-306

COVER REAC 4N O-RG 24/40 24/40

Catalog Number: 14205-306
Supplier: Wilmad-LabGlass
Image Unavailable-76051-612

VWR* Upright Eco- Freezer Rack 679 x 241 x 140 mm

Description: VWR* Upright Eco- Freezer Rack, Material: Stainless Steel, Box capacity: 5 deep & 3 high configuration 15), To hold 3in boxes, Outside Dimension: 679 x 241 x 140 mm
Catalog Number: 76051-612
Supplier: VWR International
Image Unavailable-76051-610

VWR* Upright Eco- Freezer Rack 679 x 168 x 140 mm

Description: VWR* Upright Eco- Freezer Rack, Material: Stainless Steel, Box capacity: 5 deep & 2 high configuration 10), To hold 3in boxes, Outside Dimension: 679 x 168 x 140 mm
Catalog Number: 76051-610
Supplier: VWR International
Image Unavailable-102999-804

Human Beta-Amyloid (1-40)

Description: Human Beta-Amyloid (1-40)
Catalog Number: 102999-804
Supplier: Anaspec Inc
Image Unavailable-TCB0448-100ML

Benzyltrimethylammonium Hydroxide (40% In Methanol)

Description: Benzyltrimethylammonium Hydroxide (40% In Methanol), Cas Number: 100-85-6, Molecular Formula: C10H17NO, Molecular Weight:  167.25, Size: 100ML, 100-85-6, C10H17NO, 167.25
Catalog Number: TCB0448-100ML
Supplier: TCI America

SDS Certificates


Image Unavailable-77428-752

FLUORINERTR(FC-40) 250G

Catalog Number: 77428-752
Supplier: APOLLO SCIENTIFIC
Image Unavailable-PAU1191

DUTP

Catalog Number: PAU1191
Supplier: Promega Corporation

Certificates


Image Unavailable-77428-750

FLUORINERTR(FC-40) 1KG

Catalog Number: 77428-750
Supplier: APOLLO SCIENTIFIC
Image Unavailable-102999-806

Scrambled - beta - Amyloid (1 - 40) 1 mg

Description: Scrambled - beta - Amyloid (1 - 40), human, Sequence: AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9, Apperance: Lyophilized white powder, freely soluble in basic buffer, Size: 1 mg
Catalog Number: 102999-806
Supplier: Anaspec Inc
Image Unavailable-TCB0448-500ML

, 100-85-6, C10H17NO, 167.25

Description: , 100-85-6, C10H17NO, 167.25
Catalog Number: TCB0448-500ML
Supplier: TCI America

SDS Certificates


Image Unavailable-102997-266

Human Beta-Amyloid (2-40)

Description: Human Beta-Amyloid (2-40)
Catalog Number: 102997-266
Supplier: Anaspec Inc
Image Unavailable-TCB0448-25ML

Benzyltrimethylammonium Hydroxide (40% In Methanol)

Description: 25ML, 100-85-6, C10H17NO, 167.25
Catalog Number: TCB0448-25ML
Supplier: TCI America

SDS Certificates


1,937 - 1,952 of 15,186