Print…

You Searched For: western+blotting+equipment


155,750  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"155750"

Rate These Search Results

Image Unavailable-102220-958

Mouse IgG3 Protein

Catalog Number: 102220-958
Supplier: Novus Biologicals
Image Unavailable-103278-350

CCDC9 Polyclonal Antibody 100UL

Description: CCDC9, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: IEEDRKKAELEGVAVTAPRKGRSVEKENVAVESEKNLGPSRRSPGTPRPPGASKGGRTPPQQGGRAGMGRASRSWE, Synonyms: coiled-coil domain containing 9, Application: Western Blot, IHC, IHC-P, Size: 100UL
Catalog Number: 103278-350
Supplier: Novus Biologicals
Product Image-RL209401J33S

IL-22 Antibody 25Ul

Description: Anti-Human Il-22 (Rabbit) Antibody - Il-22 Purified Antibody Has Been Tested For Use In ELISA And Western Blotting. Expect A Band Approximately 20 Kda In Size Corresponding To The Human Il-22 Protein By Western Blotting In Appropriate Cell Or Extract.
Catalog Number: RL209401J33S
Supplier: Rockland Immunochemical
Product Image-RL209401J33

IL-22 Antibody 100 Ug

Description: Anti-Human Il-22 (Rabbit) Antibody - Il-22 Purified Antibody Has Been Tested For Use In ELISA And Western Blotting. Expect A Band Approximately 20 Kda In Size Corresponding To The Human Il-22 Protein By Western Blotting In Appropriate Lysate Or Extract.
Catalog Number: RL209401J33
Supplier: Rockland Immunochemical
Image Unavailable-10218-180

FBXL17 ISOFORM 2 ANTIBODY (C-TERM)

Catalog Number: 10218-180
Supplier: Abgent
Product Image-95043-892

PDK1 (Pyruvate dehydrogenase kinase) Polyclonal Antibody. Primary Antibody.

Description: Used in Immunohistochemistry, Western blot with species reactivity to Human, Mouse, Rat, Canine, Monkey, Rabbit, Pig.
Catalog Number: 95043-892
Supplier: Enzo Life Sciences

SDS


Image Unavailable-PI31499

ImmunoPure Recomb Protein G, Peroxidase Conjugated

Description: Group: ImmunoPure Protein G Conjugates. Useful in detection systems such as Western blotting or for quantitation by ELISA. Small size of protein G (M.W.
Catalog Number: PI31499
Supplier: Invitrogen
Image Unavailable-10065-468

Rabbit anti-S tag IgG conjugated to Biotin, 100ug

Description: Polyclonal antibody, Rabbit anti-S tag IgG conjugated to Biotin, 100ug, For Western blot detection.
Catalog Number: 10065-468
Supplier: Columbia Biosciences

SDS


Product Image-76628-048

CHEMISOLO IMAGER

Catalog Number: 76628-048
Supplier: Azure Biosystems
Product Image-10128-532

Blocking Solution

Description: Blocking Solution 500ml, used to reduce nonspecific binding of immunological probes in western blotting procedures
Catalog Number: 10128-532
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-102220-574

MOUSE IgG Protein

Catalog Number: 102220-574
Supplier: Novus Biologicals
Image Unavailable-103324-320

CREM Polyclonal antibody 0.1 mg

Description: CREM Polyclonal antibody, Host: Rabbit, Reactivity: Human, Unconjugated, Immunogen: CREM (NP-001872.3, 1 aa - 137 aa) full-length human protein, Synonyms: cAMP response element modulator, Applications: Western blot, Size: 0.1 mg
Catalog Number: 103324-320
Supplier: Novus Biologicals
Image Unavailable-103324-068

CLK3 Polyclonal antibody 0.05 mg

Description: CLK3 Polyclonal antibody, Host: Mouse, Reactivity: Human, Unconjugated, Immunogen: CLK3 (AAH02555.1, 1 aa - 490 aa) full-length human protein, Synonyms: CDC-like kinase 3PHCLK3, clk3, Applications: Western blot, Size: 0.05 mg
Catalog Number: 103324-068
Supplier: Novus Biologicals
Image Unavailable-103332-436

CHMP1a Polyclonal antibody 0.1 mg

Description: CHMP1a Polyclonal antibody, Host: Rabbit, Reactivity: Human, Unconjugated, Immunogen: CHMP1A (NP-002759.2, 1 a.a. - 196 a.a.) full-length human protein, Synonyms: CHMP1, store at -20C or -80C, Applications: Western blot, Size: 0.1 mg
Catalog Number: 103332-436
Supplier: Novus Biologicals
Product Image-10040-374

Belly dancer shaker

Description: This belly dancer comes with the 18inch extension platform accessory, The extension platform measures approximately 18inch x 18inch, The undulating motion provides optimal movement for multiple stainings and washings involved in gel blotting techniques,
Catalog Number: 10040-374
Supplier: IBI Scientific

Irregular Voltage


Product Image-RL100-401-153

Cyclin D1 [Rb] Antibody

Description: Cancer Research. Apoptosis. Cell Cycle. Primary Antibodies. Expect cross reactivity with human chimpanzee orangutan rat mouse dog chicken frog and zebrafish. Applications include ELISA and WB. Size 100uL.
Catalog Number: RL100-401-153
Supplier: Rockland Immunochemical

SDS


3,681 - 3,696 of 155,750