You Searched For: silber

Corrected to: "silber"
Other possible search terms:


5,187  results were found

SearchResultCount:"5187"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (77200-010)
Supplier: Desco
Description: The bright colors of the straps and cords provide high visibility

UL Listed Product available on GSA Advantage®


Supplier: Sklar
Description: The SklarLite™ Rigid Sterilization Container System provides an organized, routine, and secure approach to the sterilization of surgical instruments

Catalog Number: (76474-344)
Supplier: Justrite
Description: Ideal for small quantity dispensing of liquids.


Supplier: Sklar
Description: Sklar's Williams Lachrimal Probe is a very thin malleable rod with a rounded end used in procedures within the lacrimal system, often pertaining to re-establishing tear flow.

Supplier: TCI America
Description: (stabilized with Silver chip) CAS Number: 870-63-3 MDL Number: MFCD00000242 Molecular Formula: C5H9Br Molecular Weight: 149.03 Purity/Analysis Method: <gt/>90.0% (GC) Form: Clear Liquid Boiling point (°C): 135 Flash Point (°C): 40 Specific Gravity (20/20): 1.29 Storage Temperature: 0-10°C
Supplier: Electron Microscopy Sciences
Description: For adhesion of specimens and particles for scanning electron microscopy examination.

Minority or Woman-Owned Business Enterprise

Supplier: Electron Microscopy Sciences
Description: Genta, Robason and Graham Stain for H-pylori & Gastric Morphology, Stain results - Muscle cells: Brownish yellow, Lamina propria ground substance: Light yellowish or grayish, Smooth muscle fibers: Light Pink

Minority or Woman-Owned Business Enterprise

Supplier: Lauda-Brinkmann
Description: ECO current replacement for Ecoline

Catalog Number: (77120-146)
Supplier: Prosci
Description: QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTN
GTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFC
NDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFK
NIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWT
AGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQ
PTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVS
PTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDS
KVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVG
YQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQF
GRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHA
DQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPGSASS
VASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECS
NLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKP
SKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTS
ALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQ
DSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLI
TGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAP
HGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITT
DNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVN
IQKEIDRLNEVAKNLNESLIDLQELGKYEQ


Supplier: Lauda-Brinkmann
Description: ECO current replacement for Ecoline

Catalog Number: (10749-584)
Supplier: Prosci
Description: ACE2 Antibody: Angiotensin-converting enzyme 2 (ACE2) plays a central role in vascular, renal, and myocardial physiology. In contrast to its homolog ACE, ACE2 expression is restricted to heart, kidney, and testis. Recently. ACE2 has also been shown to be a functional receptor of the SARS coronavirus. The normal function of ACE2 is to convert the inactive vasoconstrictor angiotensin I (AngI) to Ang1-9 and the active form AngII to Ang1-7, unlike ACE, which converts AngI to AngII. While the role of these vasoactive peptides is not well understood, lack of ACE2 expression in ace2-/ace2- mice leads to severely reduced cardiac contractility, indicating its importance in regulating heart function.


Catalog Number: (76108-942)
Supplier: Bioss
Description: CCDC18, also known as NY-SAR-41 or dJ717I23.1, is a 1,454 amino acid protein expressed as two isoforms and encoded by a gene mapping to human chromosome 1. Chromosome 1 is the largest human chromosome spanning about 260 million base pairs and making up 8% of the human genome. There are about 3,000 genes on chromosome 1, and considering the great number of genes there are also a large number of diseases associated with chromosome 1. Notably, the rare aging disease Hutchinson-Gilford progeria is associated with the LMNA gene which encodes lamin A. When defective, the LMNA gene product can build up in the nucleus and cause characteristic nuclear blebs. The mechanism of rapidly enhanced aging is unclear and is a topic of continuing exploration. The MUTYH gene is located on chromosome 1 and is partially responsible for familial adenomatous polyposis. Stickler syndrome, Parkinsons, Gaucher disease and Usher syndrome are also associated with chromosome 1. A breakpoint has been identified in 1q which disrupts the DISC1 gene and is linked to schizophrenia. Aberrations in chromosome 1 are found in a variety of cancers including head and neck cancer, malignant melanoma and multiple myeloma.


Catalog Number: (76248-472)
Supplier: ELLSWORTH ADHESIVES CUST SERV TE
Description: Heavy-duty, high temperature, anti-seize naphthenic oil thread lubricant for protecting fine threads, snug slip fits or other closely mated parts.


Catalog Number: (76376-096)
Supplier: ELECTRON MICROSCOPY SCIENCE
Description: Swiss made tweezers are for cutting hair sprigs, electronic component wires, copper, gold, silver and other soft wires. The large head produces a parallel, strong cut.


Supplier: Restek
Description: Vials have a 2 ml capacity.

Supplier: Thermo Scientific Chemicals
Description: Stab. with potassium carbonate
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,513 - 2,528 of 5,187
no targeter for Bottom