You Searched For: silber

Corrected to: "silber"
Other possible search terms:


5,187  results were found

SearchResultCount:"5187"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (10185-324)
Supplier: Sklar
Description: The Merit™ Sims Uterine Sound is a malleable, silver-plated OB/GYN instrument used for probing and dilating the uterus as well as measuring the length of the cervical canal.


Catalog Number: (AG8010-0417)
Supplier: AGILENT TECHNOLOGIES, INC (CSD)
Description: Vials with 2 ml wide opening are constructed from type 33 and type 51 COE borosilicate glass, with low metal content, to protect your sample from destabilizing or leaching.


Catalog Number: (76461-006)
Supplier: Brady Worldwide
Description: Metallized Polyester (B-434) labels are designed for applications that use barcodes, alphanumerics, graphic symbols, and logos, and also require nameplate-like quality.


Catalog Number: (11000-640)
Supplier: Honeywell Safety Products
Description: Apron features a five-layer fabric compacted into 2.7mil


Supplier: Honeywell Safety Products
Description: Uvex Ignite™ eyewear combines sleek sport-styling and a wraparound design for superior face coverage and protection. Lightweight, frameless design permits 180° of unobstructed and distortion-free vision.

Supplier: WORLD PRECISION INSTRUMENTS LLC
Description: Microelectrode holder-half-cells couple fluid-filled glass micropipettes to high input impedance amplifiers. A Ag/AgCl pellet (or a silver wire) molded into the holder body provides stable potential. Electrical connection is made via male 2 mm pins or female 2 mm sockets.

New Product

Supplier: TCI America
Description: (stabilized with Silver chip) CAS Number: 870-63-3 MDL Number: MFCD00000242 Molecular Formula: C5H9Br Molecular Weight: 149.03 Purity/Analysis Method: <gt/>90.0% (GC) Form: Clear Liquid Boiling point (°C): 135 Flash Point (°C): 40 Specific Gravity (20/20): 1.29 Storage Temperature: 0-10°C
Supplier: Electron Microscopy Sciences
Description: For adhesion of specimens and particles for scanning electron microscopy examination.

Minority or Woman-Owned Business Enterprise

Catalog Number: (77664-232)
Supplier: WORLD PRECISION INSTRUMENTS LLC
Description: WPI™s microelectrode holder-half-cells couple fluid-filled glass micropipettes to high input impedance amplifiers. A Ag/AgCl pellet (or a silver wire) molded into the holder body provides stable potential. Electrical connection is made via male 2 mm pins or female 2 mm sockets.

New Product


Catalog Number: (76275-688)
Supplier: GA INTERNATIONAL INC
Description: Writable cryo color dots and rectangles for identifying the sides and tops of cryo vials and microtubes stored in lab freezers and liquid nitrogen dewars. Easy to write on with permanent cryo markers. JTA-class labels are available in a variety of colors.


Catalog Number: (77200-010)
Supplier: Desco
Description: The bright colors of the straps and cords provide high visibility

UL Listed Product available on GSA Advantage®


Catalog Number: (76474-344)
Supplier: Justrite
Description: Ideal for small quantity dispensing of liquids.


Supplier: Sklar
Description: The SklarLite™ Rigid Sterilization Container System provides an organized, routine, and secure approach to the sterilization of surgical instruments

Catalog Number: (76632-584)
Supplier: Sino Biological
Description: It is a chimeric monoclonal antibody combining the constant domains of the human IgG1 molecule with rabbit variable regions, and the variable region was from rabbit monoclonal antibody (Cat No: 40143-R004). The chimeric monoclonal antibody was produced using recombinant antibody technology.


Catalog Number: (77120-146)
Supplier: Prosci
Description: QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTN
GTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFC
NDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFK
NIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWT
AGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQ
PTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVS
PTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDS
KVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVG
YQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQF
GRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHA
DQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPGSASS
VASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECS
NLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKP
SKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTS
ALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQ
DSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLI
TGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAP
HGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITT
DNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVN
IQKEIDRLNEVAKNLNESLIDLQELGKYEQ


Catalog Number: (89417-316)
Supplier: Prosci
Description: ARHGAP18 Antibody: ARHGAP18 is one member of the human RhoGAP family with approximately 80 RhoGAP proteins known to be encoded in the human genome. Rho proteins belong to the Ras superfamily that is composed of over 50 members divided into six families, including Ras, Sar, Rho, Ran, Rab and Arf. Rho GTPases are important regulators of the actin cytoskeleton and consequently influence the shape and migration of cells. ARHGAP18 is linked to Ras, and thus, to EGFR-mediated proliferation, migration and differentiation. ARHGAP18 is precisely contained within chromosome 6q22-24, which has been shown to be linked to schizophrenia, suggesting that ARHGEP18 may play a role in this condition.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,497 - 2,512 of 5,187
no targeter for Bottom