You Searched For: silber

Corrected to: "silber"
Other possible search terms:


5,007  results were found

SearchResultCount:"5007"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103824-922)
Supplier: Sino Biological
Description: This product is a recombinant monoclonal antibody expressed from HEK293 cells.


Supplier: AGILENT TECHNOLOGIES, INC (CSD)
Description: Cap, crimp, silver aluminum, 11 mm, PTFE/red rubber septa. Cap size: 11 mm

Catalog Number: (76759-234)
Supplier: Prosci
Description: Anti-Spike Protein Recombinant Antibody [clone: 2165] (HRP)


Catalog Number: (89415-632)
Supplier: Prosci
Description: ACE2 Antibody: Angiotensin-converting enzyme 2 (ACE2) plays a central role in vascular, renal, and myocardial physiology. In contrast to its homolog ACE, ACE2 expression is restricted to heart, kidney, and testis. Recently. ACE2 has also been shown to be a functional receptor of the SARS coronavirus. The normal function of ACE2 is to convert the inactive vasoconstrictor angiotensin I (AngI) to Ang1-9 and the active form AngII to Ang1-7, unlike ACE, which converts AngI to AngII. While the role of these vasoactive peptides is not well understood, lack of ACE2 expression in ace2-/ace2- mice leads to severely reduced cardiac contractility, indicating its importance in regulating heart function.


Catalog Number: (89415-642)
Supplier: Prosci
Description: ACE2 Antibody: Angiotensin-converting enzyme 2 (ACE2) plays a central role in vascular, renal, and myocardial physiology. In contrast to its homolog ACE, ACE2 expression is restricted to heart, kidney, and testis. Recently. ACE2 has also been shown to be a functional receptor of the SARS coronavirus. The normal function of ACE2 is to convert the inactive vasoconstrictor angiotensin I (AngI) to Ang1-9 and the active form AngII to Ang1-7, unlike ACE, which converts AngI to AngII. While the role of these vasoactive peptides is not well understood, lack of ACE2 expression in ace2-/ace2- mice leads to severely reduced cardiac contractility, indicating its importance in regulating heart function.


Catalog Number: (76749-160)
Supplier: Prosci
Description: Anti-Anti Spike Glycoprotein antibody Monoclonal Antibody


Catalog Number: (77129-916)
Supplier: Prosci
Description: Native Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ Amino acids S1 – Q306 (end). Residue S237 of the fusion protein is equivalent to S1 of the native enzyme. The GST tag is located at residues 1 – 220 and the His6 tag is located at residues 545– 550. Has C-terminal 5’ residues of NSP4 (residues 232 – 236) between PreScission site and N-terminus of NSP5 – corresponding to the cleavage site between NSP4 and NSP5 in the polyprotein of the SARS CoV virus to generate an authentic N-terminus during gene expression. The C-terminus encodes for a modified PreScission cleavage site before the His6 tag to generate an authentic C-terminus when cleaved, SGVTFQGP, residues 537 - 544. Protease Cleavage: Modified PreScission - SGVTFQGP, residues 537 - 544


Catalog Number: (94003-032)
Supplier: National Marker
Description: Display on desks, counter tops or on any flat surface.


Catalog Number: (89415-630)
Supplier: Prosci
Description: ACE2 Antibody: Angiotensin-converting enzyme 2 (ACE2) plays a central role in vascular, renal, and myocardial physiology. In contrast to its homolog ACE, ACE2 expression is restricted to heart, kidney, and testis. Recently. ACE2 has also been shown to be a functional receptor of the SARS coronavirus. The normal function of ACE2 is to convert the inactive vasoconstrictor angiotensin I (AngI) to Ang1-9 and the active form AngII to Ang1-7, unlike ACE, which converts AngI to AngII. While the role of these vasoactive peptides is not well understood, lack of ACE2 expression in ace2-/ace2- mice leads to severely reduced cardiac contractility, indicating its importance in regulating heart function.


Catalog Number: (76631-494)
Supplier: Sino Biological
Description: This product is a recombinant monoclonal antibody expressed from HEK293 cells and then biotinylated.


Catalog Number: (76631-150)
Supplier: Sino Biological
Description: This product is a recombinant monoclonal antibody expressed from HEK293 cells and then biotinylated.


Catalog Number: (76749-282)
Supplier: Prosci
Description: Anti-Surface Glycoprotein Human Recombinant Monoclonal Antibody [clone: 2B7]


Catalog Number: (76471-764)
Supplier: TrippNT
Description: TrippNT's Core 6D offer 6 total locking drawers for flexible organization and storage.


Catalog Number: (97001-694)
Supplier: Mettler Toledo
Description: Electrode measures oxidation/reduction power of a solution

Product available on GSA Advantage®


Catalog Number: (76276-494)
Supplier: National Public Seating
Description: High-quality cafe time adjustable-height table is of a great value.


Catalog Number: (76756-324)
Supplier: Prosci
Description: Anti-Spike Protein Recombinant Antibody [clone: 2146] (HRP)


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,209 - 2,224 of 5,007
no targeter for Bottom