You Searched For: silber

Corrected to: "silber"
Other possible search terms:


4,967  results were found

SearchResultCount:"4967"

Sort Results

List View Easy View (new)

Rate These Search Results

Supplier: AMBEED, INC
Description: Indiumselenide, Purity: 99.99% approx 60M, CAS Number: 12056-07-4, Appearance: Grey to Dark Silver Powder or crystals, Storage: Inert atmosphere, Room Temperature, Size: 25G

Catalog Number: (10058-658)
Supplier: Restek
Description: For use with Agilent 6890 GC systems.


Supplier: G-Biosciences
Description: Used for destaining and removal of silver ions prior to trypsin digestion.

Catalog Number: (76752-552)
Supplier: Prosci
Description: Anti-Angiotensin-converting enzyme 2 Recombinant Antibody


Catalog Number: (77131-098)
Supplier: Prosci
Description: SARS-CoV-2 (COVID-19) Nucleocapsid antibody can be stored at 4 °C for three months and −20 °C, stable for up to one year. As with all antibodies care should be taken to avoid repeated freeze thaw cycles. Antibodies should not be exposed to prolonged high temperatures.


Catalog Number: (77129-916)
Supplier: Prosci
Description: Native Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ Amino acids S1 – Q306 (end). Residue S237 of the fusion protein is equivalent to S1 of the native enzyme. The GST tag is located at residues 1 – 220 and the His6 tag is located at residues 545– 550. Has C-terminal 5’ residues of NSP4 (residues 232 – 236) between PreScission site and N-terminus of NSP5 – corresponding to the cleavage site between NSP4 and NSP5 in the polyprotein of the SARS CoV virus to generate an authentic N-terminus during gene expression. The C-terminus encodes for a modified PreScission cleavage site before the His6 tag to generate an authentic C-terminus when cleaved, SGVTFQGP, residues 537 - 544. Protease Cleavage: Modified PreScission - SGVTFQGP, residues 537 - 544


Supplier: SI Analytics
Description: Metal combination electrodes with plug head and connection cable with silver/silver chloride reference system.

Supplier: BeanTown Chemical
Description: MDL Number: MFCD00003397, Signal word: Warning.

SDS

Supplier: SPANISH FORK FOUNDRY
Description: A full line of cast iron gold and silver mold products are available.

Supplier: Electron Microscopy Sciences
Description: A Combined Hematoxylin and Eosin/Methenamine Silver Stain is used for the Histological Diagnosis of Fungi in Tissue Sections.

SDS Minority or Woman-Owned Business Enterprise

Catalog Number: (76761-876)
Supplier: Prosci
Description: Anti-Nucleoprotein Rabbit Polyclonal Antibody


Supplier: NANOCOMPOSIX, INC.
Description: Bimetallic Silver-Shelled Gold Nanospheres with displaceable citrate surface.

New Product

Supplier: TCI America
Description: CAS Number: 97-78-9 MDL Number: MFCD00021749 Molecular Formula: C15H29NO3 Molecular Weight: 271.40 Purity/Analysis Method: <gt/>90.0% (GC) Melting point (°C): 46 Flash Point (°C): 210
Catalog Number: (76749-282)
Supplier: Prosci
Description: Anti-Surface Glycoprotein Human Recombinant Monoclonal Antibody [clone: 2B7]


Catalog Number: (76553-984)
Supplier: Healthcare Products
Description: The QuickVue At-Home OTC COVID-19 Test (nasal) is intended for the qualitative detection of nucleocapsid proteins from SARS-CoV-2 from individuals with or without symptoms or other epidemiological reasons to suspect COVID-19 when tested twice over two or three days with at least 24 hours and no more than 36 hours between tests.


Supplier: Thermo Scientific Chemicals
Description: Applications: Silver plating
Soluble in water
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,097 - 2,112 of 4,967
no targeter for Bottom