Print…

You Searched For: Rego+X-ray+GmbH


2,873  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"2873"

Rate These Search Results

Product Image-470230-212

Mounted Color Filters; 7 Monochromatic And 1 Tri-Color

Catalog Number: 470230-212
Supplier: Wards
Image Unavailable-470223-187

Bulb, Incandescent, For Rive Ray Box, Power: 20W

Catalog Number: 470223-187
Supplier: OSAW INDUSTRIAL PRODUCTS SE
Product Image-10769-914

Scoop

Description: LaboPlast* Bio scoop, Capacity: 100 ml, Length: 205 mm, renewable raw materials, Bio Polyethylene, white, sterilised by gamma rays, With EU foodstuffs and FDA approval, ideal for powders, granulates and pastes.
Catalog Number: 10769-914
Supplier: BURKLE INC

Environmentally Preferable


Product Image-10769-718

Scoop

Description: LaboPlast* scoop, disposable, Polystyrene, white, made of renewable raw materials, sterilised by gamma rays, Production and packaging according to clean room class 7, With EU foodstuffs and FDA approval, 150 ml, 216 mm
Catalog Number: 10769-718
Supplier: BURKLE INC

Environmentally Preferable


Product Image-10769-912

Scoop

Description: SteriPlast* Bio sample scoop, Capacity: 100 ml, Length: 205 mm, renewable raw materials, Green Polyethylene, white, sterilised by gamma rays, With EU foodstuffs and FDA approval, ideal for powders, granulates and pastes.
Catalog Number: 10769-912
Supplier: BURKLE INC

Environmentally Preferable


Product Image-10769-668

Scoop

Description: SteriPlast* Bio sample scoop, Green Polyethylene, white, made of renewable raw materials, sterilised by gamma rays, Production and packaging according to clean room class 7, With EU foodstuffs and FDA approval, Length: 216 mm, 150 ml
Catalog Number: 10769-668
Supplier: BURKLE INC

Environmentally Preferable


Image Unavailable-76173-906

Ku70 Picoband* Polyclonal Antibody 100ug/vial

Description: Ku70 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD, Synonyms: X-ray repair cross-complementing protein 6, 3.6.4.-, 4.2.99, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-906
Supplier: Boster Biological Technology
Product Image-89001-270

Flasks Boiling Flat Bottom Short Neck RAY-SORB Full Length [standard taper] 24/40 Joint

Description: Capacity (mL); 250. Approx. Height (mm); 133. Approx. O.D. (mm); 83 KIMAX boiling flask is RAY-SORB processed to provide protection to solutions sensitive to light of the shorter wavelengths.
Catalog Number: 89001-270
Supplier: DWK Life Sciences (KIMBLE)

Certificates


Product Image-46620-016

Reclosable Amber Bags

Description: Special amber polyethylene film blocks out ultraviolet rays providing ultimate protection for light-sensitive products. Reusable and protects contents from dust and moisture. Size: 10.1x15.2cm.
Catalog Number: 46620-016
Supplier: Minigrip
Product Image-46620-014

Reclosable Amber Bags

Description: Special amber polyethylene film blocks out ultraviolet rays providing ultimate protection for light-sensitive products. Reusable and protects contents from dust and moisture. Size: 7.6x12.7cm.
Catalog Number: 46620-014
Supplier: Minigrip

Certificates


Product Image-470149-474

OPTICS SET - PLASTIC

Catalog Number: 470149-474
Supplier: Shiv Dial Sud & Sons
Image Unavailable-103301-794

Dry Box Gloves Polyurethane/Chlorosulphonated Polyethylene Monomer

Description: Dry Box Gloves Polyurethane/Chlorosulphonated Polyethylene Monomer, Puncture and Tear Resistance. In Situ Leak Detectors. Resistant to UV Rays/Ozone and to Reducing Acids, Diluted Acids, Alkalis and Salts. Temperature Limit: 160F.
Catalog Number: 103301-794
Supplier: Piercan USA
Product Image-10769-692

Spoon

Description: LaboPlast* spoon, disposable, Polystyrene, white, made of renewable raw materials, sterilised by gamma rays, Production and packaging according to clean room class 7, With EU foodstuffs and FDA approval, 127 mm, 10 ml, ideal for sampling powders, granulates and fluids.
Catalog Number: 10769-692
Supplier: BURKLE INC
Product Image-10769-688

Spoon

Description: SteriPlast* sample spoon, Polystyrene, white, made of renewable raw materials, sterilised by gamma rays, Production and packaging according to clean room class 7, With EU foodstuffs and FDA approval, 170 mm, 10 ml, ideal for sampling powders, granulates and fluids.
Catalog Number: 10769-688
Supplier: BURKLE INC
Image Unavailable-103375-260

Gloves 15mil

Description: Gloves, Material: EPDM, Color: Black, Antistatic, Compatible with VHP Autoclave, Excellent Chemical Resistance, High Resistance to UV Rays/Ozone, Good flexibility and dexterity, High Temperature Limit: 260 deg F, Thickness: 15mil, Length: 13in, Size: 8A
Catalog Number: 103375-260
Supplier: Piercan USA
Product Image-10769-922

Spoon

Description: LaboPlast* Bio spoon, made of renewable raw materials, Green Polyethylene, white, sterilised by gamma rays, Production and packaging according to clean room class 7, With EU foodstuffs and FDA approval, Length: 127 mm, Capacity: 2. 5 ml, for sampling powders, granulates and fluids.
Catalog Number: 10769-922
Supplier: BURKLE INC
481 - 496 of 2,873