Print…

You Searched For: Methyl 4-Aminoindole-6-carboxylate


6  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"6"

Rate These Search Results

Image Unavailable-103014-750

Human IL-18BP Protein Fc Tag 1MG

Description: IL-18BP Protein, Fc Tag, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization:  human IgG1 Fc tag at the C-terminus, MW of 44.3 kDa, Synonym: IL18BP, IL18BPa, Tadekinig-alfa, Storage: 4 deg C, Size: 1MG
Catalog Number: 103014-750
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-044

Rat FcRn/FCGRT & B2M Heterodimer Protein 50ug

Description: FcRn/FCGRT & B2M Heterodimer Protein, Host: HEK293 Cells, Species: Rat, Purity: >95% SDS-PAGE, Molecular Characterization: fused with his-tag at C-terminus and subunit Beta-2 microglobulin, MW 31.8 kDa, Synonym: FcRn, FCGRT & B2M, Size: 50ug
Catalog Number: 103013-044
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-086

Cynomolgus B7-2/CD86 Protein

Description: B7-2/CD86 Protein, Host: HEK293 cells, Species Reactivity: Cynomolgus, Purity: >95% (SDS-PAGE), Molecular Characterization: Fused with a polyhistidine tag at C-terminus, MW of 27.3 KDa, Synonyms: CD86,B7-2,B70,CD28LG2,LAB72,MGC34413, Storage: 4 deg C, Size: 1mg
Catalog Number: 103014-086
Supplier: ACROBIOSYSTEMS
Image Unavailable-103003-726

Exendin 4 1 mg

Description: Exendin 4, Purity: HPLC >/- 95%, Molecular Weight: 4186.6, Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Appearance: Lyophilized white powder, is an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake, Size: 1 mg
Catalog Number: 103003-726
Supplier: Anaspec Inc
Image Unavailable-103006-594

P53 (17-26) 1 mg

Description: P53 (17-26) sequence contains the residues that contact the binding domain of Mdm-2, important in maintaining genome stability and preventing cancer development, Purity: HPLC>/=95%, Sequence (One-Letter Code): ETFSDLWKLL, Molecular weight: 1251.5, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-594
Supplier: Anaspec Inc
Image Unavailable-103013-234

Recombinant [A/Hong Kong/483/97 (H5N1)] (HA)

Description: Recombinant [A/Hong Kong/483/97 (H5N1)] Hemagglutinin (HA), Host: HEK293 Cells, Species reactivity: Influenza, Purity: >95% SDS-PAGE, Molecular Characterization: Fused with a polyhistidine tag at C-terminus, MW of 60.3 kDa, Synonym: HA, Size: 100ug
Catalog Number: 103013-234
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-260

ROR1 (308-395, Kringle domain) Protein 1mg

Description: ROR1 (308-395, Kringle domain) Protein, Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 10.8 kDa, Synonym: ROR1,NTRKR1, Storage: 4 deg C, Size: 1mg
Catalog Number: 103015-260
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-232

Recombinant [A/Hong Kong/483/97 (H5N1)] (HA)

Description: Recombinant [A/Hong Kong/483/97 (H5N1)] Hemagglutinin (HA), Host: HEK293 Cells, Species reactivity: Influenza, Purity: >95% SDS-PAGE, Molecular Characterization: Fused with a polyhistidine tag at C-terminus, MW of 60.3 kDa, Synonym: HA, Size: 1mg
Catalog Number: 103013-232
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-262

ROR1 (308-395, Kringle domain) Protein 50ug

Description: ROR1 (308-395, Kringle domain) Protein, Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 10.8 kDa, Synonym: ROR1,NTRKR1, Storage: 4 deg C, Size: 50ug
Catalog Number: 103015-262
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-440

Human HSP90AA1/HSP86 Protein GST Tag

Description: HSP90AA1 / HSP86 Protein, GST Tag, Host: HEK293 Cells, Species Reactivity: Human, purity: >85%, Molecular Characterization: MW of 49.3 kDa, Synonym: HSP90AA1, HSP90A, HSP 86, HSP86, HSPC1, HSPCA, EL52, HSP89A, Storage: 4 deg C, Size: 100UG
Catalog Number: 103014-440
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-438

Human HSP90AA1/HSP86 Protein GST Tag

Description: HSP90AA1 / HSP86 Protein, GST Tag, Host: HEK293 Cells, Species Reactivity: Human, purity: >85%, Molecular Characterization: MW of 49.3 kDa, Synonym: HSP90AA1, HSP90A, HSP 86, HSP86, HSPC1, HSPCA, EL52, HSP89A, Storage: 4 deg C, Size: 1MG
Catalog Number: 103014-438
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-100

PCSK9 Protein 1mg

Description: PCSK9 Protein, Host: HEK293, Species Reactivity: Rhesus macaque, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 73.2 kDa, Synonym: PCSK9,FH3,HCHOLA3,LDLCQ1,NARC1,PC9, Storage: 4 degree Celcius, Size: 1mg
Catalog Number: 103015-100
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-900

Human CD58/LFA-3 Protein 1MG

Description: CD58 / LFA-3 Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: 6xHis tag at the C-terminus, MW of 22.3 kDa, Endotoxin: Less than 1.0 EU per ug, Synonym: CD58, LFA3, Ag3, Storage: 4 deg C, Size: 1MG
Catalog Number: 103014-900
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-096

Human CD46 Protein 50ug

Description: CD46 Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: His Tag is fused with a polyhistidine tag at the C-terminus, MW of 33.6 KDa, Synonyms: CD46,AHUS2,MCP,MIC10,TLX,TRA2.10, Storage: 4 deg C, Size: 50ug
Catalog Number: 103014-096
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-902

Human CD58/LFA-3 Protein 100UG

Description: CD58 / LFA-3 Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: 6xHis tag at the C-terminus, MW of 22.3 kDa, Endotoxin: Less than 1.0 EU per ug, Synonym: CD58, LFA3, Ag3, Storage: 4 deg C, Size: 100UG
Catalog Number: 103014-902
Supplier: ACROBIOSYSTEMS
Image Unavailable-103012-766

Human DLL1/Delta1 Protein 100ug

Description: Human DLL1/Delta1 Protein, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with polyhistidine tag at the C-terminus, MW of 58.4 kDa, Endotoxin: Less than 1.0 EU per ug of the rh DLL1, size: 100ug
Catalog Number: 103012-766
Supplier: ACROBIOSYSTEMS
1 - 6 of 6