Print…

You Searched For: Rego+X-ray+GmbH


2,873  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"2873"

Rate These Search Results

Product Image-102096-922

Pcc Cut Papr Linr 45236 5/Pk

Catalog Number: 102096-922
Supplier: Electron Microscopy Sciences


Product Image-102096-918

Pcc Unct Papr Lindr 45232 5/Pk

Catalog Number: 102096-918
Supplier: Electron Microscopy Sciences


Product Image-102096-924

Pcc Cut Plastc Linr 45237 5/Pk

Catalog Number: 102096-924
Supplier: Electron Microscopy Sciences


Product Image-102096-920

Prcrylc Uncut Plastc Linr 5/Pk

Catalog Number: 102096-920
Supplier: Electron Microscopy Sciences


Product Image-500011-860

Folder,Hng,14X18,25Bx,Grn

Description: Pendaflex Reinforced Hanging File Folders, Kraft, X-Ray 18 X 14, Standard Green, 25/Box
Catalog Number: 500011-860
Supplier: Janitorial Supplies

Environmentally Preferable


Product Image-76025-070

Sign Caution X-Ray In Adhesive 7X10in

Description: Radiation Sign, Recycled Polystyrene Self-Adhesive, X-Ray In Use, resistant to solvents, moisture, scuffing and UV exposure, high tear resistance, UL Validated for recycled content, 7x10in
Catalog Number: 76025-070
Supplier: ZING Enterprises

Environmentally Preferable


Product Image-76182-276

Micro X-CELL* 31mm

Description: Micro X-CELL*, Disposable X-ray cell with collar, Features: 6.3 mm window is centered in standard 31mm sample holder, Material: Polyethylene, Aperture: 6.3mm, Capacity: 0.5ml, Outer Diameter: 1.244in, Can be run with open back, sealed
Catalog Number: 76182-276
Supplier: SPEX
Product Image-76182-274

Micro X-CELL* 31mm

Description: Micro X-CELL*, Disposable X-ray cell with collar, Features: 6.3 mm window is centered in standard 31mm sample holder, Material: Polyethylene, Aperture: 6.3mm, Capacity: 0.5ml, Outer Diameter: 1.244in, Can be run with open back, sealed
Catalog Number: 76182-274
Supplier: SPEX
Image Unavailable-101377-860

LABEL - FLORESCENT CHART 4 X

Catalog Number: 101377-860
Supplier: Label Master
Product Image-76025-068

Sign Caution X-Ray In Aluminium 7X10in

Description: Radiation Sign, Recycled Aluminum, X-Ray In Use, complies with 29 CFR 1910.1030(g)(1), pre-drilled mounting holes, durable indoor and outdoor use with UV protection, UL Validated for recycled content, 7x10in
Catalog Number: 76025-068
Supplier: ZING Enterprises

Environmentally Preferable


Product Image-470224-154

CSA Rive Ray Box

Catalog Number: 470224-154
Supplier: OSAW INDUSTRIAL PRODUCTS SE
Product Image-30353-032

KIMAX* brand Separatory Funnel, RAY-SORB*, Squibb, Pear-Shape, PTFE Stopcock, PTFE Stopper

Description: Capacity: 250ml. Stopcock Plug Size: 4. Stopper number: 22. Yellow handle. Large, lower stem I.D. RAY-SORB protects materials sensitive to light of shorter wavelengths. ASTM Specification E1096, Type IV.
Catalog Number: 30353-032
Supplier: DWK Life Sciences (KIMBLE)
Product Image-30353-054

KIMAX* brand Separatory Funnel, RAY-SORB*, Squibb, Pear-Shape, PTFE Stopcock, PTFE Stopper

Description: Capacity: 500ml. Stopcock Plug Size: 4. Stopper number: 27. Red handle. Large, lower stem I.D. RAY-SORB protects materials sensitive to light of shorter wavelengths. ASTM Specification E1096, Type IV.
Catalog Number: 30353-054
Supplier: DWK Life Sciences (KIMBLE)
Product Image-30353-010

KIMAX* brand Separatory Funnel, RAY-SORB*, Squibb, Pear-Shape, PTFE Stopcock, PTFE Stopper

Description: Capacity: 125ml. Stopcock Plug Size: 2. Stopper number: 22. Yellow handle. Large, lower stem I.D. RAY-SORB protects materials sensitive to light of shorter wavelengths. ASTM Specification E1096, Type IV.
Catalog Number: 30353-010
Supplier: DWK Life Sciences (KIMBLE)

Certificates


Image Unavailable-76173-906

Ku70 Picoband* Polyclonal Antibody 100ug/vial

Description: Ku70 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD, Synonyms: X-ray repair cross-complementing protein 6, 3.6.4.-, 4.2.99, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-906
Supplier: Boster Biological Technology
Product Image-10769-914

Scoop

Description: LaboPlast* Bio scoop, Capacity: 100 ml, Length: 205 mm, renewable raw materials, Bio Polyethylene, white, sterilised by gamma rays, With EU foodstuffs and FDA approval, ideal for powders, granulates and pastes.
Catalog Number: 10769-914
Supplier: BURKLE INC

Environmentally Preferable


465 - 480 of 2,873