Print…

You Searched For: Monarch+RNA+Cleanup+Kits


119,121  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"119121"

Rate These Search Results

Image Unavailable-10255-414

CRSP9 Antibody

Description: CRSP9 Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Cofactor required for Sp1 transcriptional activation subunit 9, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10255-414
Supplier: Bioss
Image Unavailable-10255-410

CRSP9 Antibody

Description: CRSP9 Polyclonal Antibody, Host: Rabbit, Cy7 Conjugated, Emmission: 743nm/767nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Cofactor required for Sp1 transcriptional activation subunit 9, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10255-410
Supplier: Bioss
Image Unavailable-103258-798

RBM28 Polyclonal 100ul

Description: RBM28, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: Igg, Immunogen: This antibody was developed against Recombinant Protein, Synonyms: RNA binding motif protein 28, RNA-binding motif protein 28,2810480G15Rik, Applications: WB, ICC/IF, IHC, IHC-P, Size: 100ul
Catalog Number: 103258-798
Supplier: Novus Biologicals
Image Unavailable-76174-462

PKR Picoband* Polyclonal Antibody 100ug/vial

Description: PKR Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PKR(511-551aa EKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC, Size: 100ug/vial
Catalog Number: 76174-462
Supplier: Boster Biological Technology
Product Image-89418-008

Antibody PIWI-L2 0.1MG

Description: polyclonal antibody PIWI-like 2 protein Host: rabbit species reactivity: human mouseIsotype: IgG Immunogen: PIWI-L2 Antibody was raised against a 17 amino acid synthetic peptide near the center of human PIWI-L2 Application: Western blot
Catalog Number: 89418-008
Supplier: Prosci
Image Unavailable-89359-360

Mouse Monoclonal antibody to Topoisomerase I (topoisomerase (DNA) I)

Description: Clone: Mab1 Purity: Protein A purified Species Reactivity: Human Tested Applications: WB Pkg Size: 50 ul
Catalog Number: 89359-360
Supplier: Genetex
Image Unavailable-10749-688

SARS MATRIX antibody

Description: SARS MATRIX antibody, polyclonal, Host: Rabbit, Species reactivity: Virus, Isotype: IgG, Immunogen: SARS matrix antibody was raised against a synthetic peptide corresponding to amino acids at the amino-terminus of the SARS matrix protein, Applications:ELISA
Catalog Number: 10749-688
Supplier: Prosci
Image Unavailable-PAL5671

Vector

Description: PF3A Wg (Bydv) Flexi(R) Vector, simple, yet powerful, directional cloning method for protein-coding sequences, based on two rare-cutting restriction enzymes, SgfI and PmeI, and provides a rapid, efficient and high-fidelity way to transfer protein-coding regions, Size: 20ug
Catalog Number: PAL5671
Supplier: Promega Corporation

SDS Certificates


Product Image-10097-072

Anti-WBP1

Description: Anti-WBP1 Antibody, Host Species: Rabbit, Cross Reactivity: Human, Immunogen: Recombinant Protein, 1-269 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, Recommended Storage: - 20 C or lower
Catalog Number: 10097-072
Supplier: Proteintech
Image Unavailable-AAAL13159-14

Acridine Orange

Description: 3,6-Bis(dimethylamino)acridine hydrochloride zinc chloride double salt C. I. 46005. Grade: NA. Melting Point C. Boiling Point C: NA. C17H20Cl3N3Zn. 10127-02-3. POSSIBLE MUTAGEN HYGROSCOPIC
Catalog Number: AAAL13159-14
Supplier: Thermo Scientific Chemicals

SDS Certificates


Image Unavailable-89363-418

Goat Polyclonal antibody to Influenza A

Description: Conjugation: HRP Species Reactivity: Other Tested Applications: ELISA, EIA Pkg Size: 100 ul
Catalog Number: 89363-418
Supplier: Genetex
Image Unavailable-77007-494

MAB SARS-COV-2 S 417N NEUTRALIZING 100UG

Catalog Number: 77007-494
Supplier: Genscript
Product Image-76407-352

Dna Ligase Hi-T4 100000 Units

Description: Hi-T4* DNA Ligase, engineered variant of T4 DNA Ligase with improved thermostability compared to T4 DNA Ligase, seals nicks for these DNA substrates, Supplied with both T4 DNA Ligase Buffer and StickTogether* DNA Ligase Buffer, Size: 100000 units
Catalog Number: 76407-352
Supplier: New England Biolabs (NEB)
Image Unavailable-10347-592

ENDONUCLEASE G Antibody

Description: ENDONUCLEASE G Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: EndoG; Endonuclease G, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10347-592
Supplier: Bioss
Image Unavailable-10355-810

IRF7 SER471 + SER472 ANTIBODY

Catalog Number: 10355-810
Supplier: Bioss
Image Unavailable-76099-858

PAB RABBIT HEAB HU IGG AF680 100UL F/IF

Catalog Number: 76099-858
Supplier: Bioss
5,553 - 5,568 of 119,121