You Searched For: Monarch+RNA+Cleanup+Kits


119,121  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"119121"
Catalog Number: 80058-782
Supplier: MilliporeSigma

Description: 100mg CAS: 63231-63-0, MDL: MFCD00132195 Powder
Catalog Number: AAJ61215-MC
Supplier: Thermo Scientific Chemicals

Description: E-GEL
Catalog Number: 95015-626
Supplier: Lonza

Description: E-GEL
Catalog Number: 95015-628
Supplier: Lonza

Catalog Number: 76210-396
Supplier: Thermo Scientific

Irregular Voltage


Description: FOX2/RBM9 Polyclonal Antibody, Host: Rabbit, Cy3 Conjugated, Emmission: 512, 550nm/570, 615nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: HRNBP2; Fox 1 homologue; Fox-1 homolog B, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10283-020
Supplier: Bioss


Description: 1,000 units
Catalog Number: 101228-350
Supplier: New England Biolabs (NEB)

Description: 5,000 units.
Catalog Number: 101228-348
Supplier: New England Biolabs (NEB)

Small Business Enterprise


Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human, Mouse Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89358-828
Supplier: Genetex


Description: Staufen Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 532-568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN, Synonyms: Double-stranded RNA-binding protein Staufen homolog 1, STAU1, STAU, Size: 100ug/vial
Catalog Number: 76174-630
Supplier: Boster Biological Technology


Description: Polyclonal, Host: Rabbit; Species reactivity: Human, Dog; Immunogen: Produced in rabbits immunized with a synthetic peptide corresponding a region of human DAZ4; Purified by peptide affinity chromatography method; Applications: Elisa, Western Blotting, IHC
Catalog Number: 10107-816
Supplier: Prosci


Description: RNA polymerase II Polyclonal Antibody, Host: Rabbit , FITC Conjugated, Emmission: 494nm/518nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: POLR2A; POLR2; DNA directed RNA polymerase II A, Application: IF(IHC-P), 100ul
Catalog Number: 10458-832
Supplier: Bioss


Description: SMYD3 Polyclonal Antibody, Host: Rabbit , Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ZMYND 1; ZMYND1; ZNFN3A1, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10427-646
Supplier: Bioss


Description: Matrin 3 Polyclonal Antibody, Host: Rabbit , Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: MATR3; Matrin3, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10409-408
Supplier: Bioss


Catalog Number: 71002-686
Supplier: Biotium


Catalog Number: 71002-684
Supplier: Biotium


4,065 - 4,080 of 119,121