Print…

You Searched For: Monarch+RNA+Cleanup+Kits


119,188  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"119188"

Rate These Search Results

Image Unavailable-76100-664

PAB RABBIT INT11 HU IGG AF750 100UL F/IF

Catalog Number: 76100-664
Supplier: Bioss
Product Image-10097-304

Anti-ZNF143

Description: Anti-ZNF143 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 283-626 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, Recommended Storage: - 20 C or lower
Catalog Number: 10097-304
Supplier: Proteintech
Image Unavailable-89358-798

Rabbit Polyclonal antibody to EIF2C2 (eukaryotic translation initiation factor 2C, 2)

Description: Purity: Purified by antigen-affinity chromatography. Tested Applications: WB-Ag Pkg Size: 100 ul
Catalog Number: 89358-798
Supplier: Genetex
Product Image-76012-172

RPP38 Polyclonal antibody 400ul

Description: RPP38 Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: Ig, Immunogen: Synthetic peptide between248-277 amino acids from the C-terminal region of human RPP38, Synonyms: Ribonuclease P protein subunit p38, RNaseP protein p38, RPP38, Uses: WB, Size: 400ul
Catalog Number: 76012-172
Supplier: Prosci
Image Unavailable-10166-620

TAF7 antibody

Description: TAF7 antibody, polyclonal, Host: Rabbit, Species Reactivity: Human, Isotype: IgG, Immunogen: Recombinant fragment contain a sequence corresponding to a region within amino acids 81 and 314, Synonyms: TAFII55 Antibody, TAF2F Antibody, TAF7 RNA polymerase II
Catalog Number: 10166-620
Supplier: Genetex
Product Image-10070-684

SRA Antibody

Description: Monoclonal antibody SRA Host: Mouse Clone no: 7H1G1 Species reactivity: human isotype: IgG1 immunogen: Ni-NTA purified truncated recombinant SRA expressed in E. Coli strain BL21 (DE3). Tested application: ELISA, WB, IHC
Catalog Number: 10070-684
Supplier: Prosci
Image Unavailable-PAG8261

The pFN29A His6HaloTag* T7 Flexi* Vector

Description: Is configured to append the His6HaloTag* tag to the aminoterminus of the protein fusion partner and provides T7 RNA polymerase-driven protein expression in E. coli.
Catalog Number: PAG8261
Supplier: Promega Corporation
Image Unavailable-77438-538

ANTIBODY MED12/TRAP230 POLYCLONAL 100UL

Catalog Number: 77438-538
Supplier: Bioss
Image Unavailable-10801-124

Anti-DDX60 Rabbit Polyclonal Antibody

Description: Anti-DDX60 Rabbit Polyclonal Antibody
Catalog Number: 10801-124
Supplier: Rockland Immunochemical
Product Image-10106-426

DDX42 Antibody

Description: Polyclonal, Host:Rabbit, Species reactivity:Human, Mouse, Rat, Immunogen:Produced in rabbits immunized with a synthetic peptide corresponding a region of human DDX42, purified by protein A chromatography method, Application:Elisa
Catalog Number: 10106-426
Supplier: Prosci
Image Unavailable-76174-026

EWSR1 Picoband* Polyclonal Antibody 100ug/vial

Description: EWSR1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH, Synonyms: RNA-binding protein EWS, EWS oncogene, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-026
Supplier: Boster Biological Technology
Product Image-10750-394

RNASE H2A antibody

Description: RNASE H2A antibody, Polyclonal, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: RNAse H2A antibody was raised against a 17 amino acid synthetic peptide near the center of human RNAse H2A, Tested applications: ELISA, ICC, IF, WB
Catalog Number: 10750-394
Supplier: Prosci
Image Unavailable-89367-666

Mouse Monoclonal antibody to RNP M3-M4

Description: Clone: 2A6 Purity: Ascitic fluid Species Reactivity: Human, Mouse, Rabbit, Rat Tested Applications: ICC/IF, IP, WB Pkg Size: 100 ul
Catalog Number: 89367-666
Supplier: Genetex
Image Unavailable-BJBR663-4X2.5L

0.02M IODINE IN THF/PYRID/WATER 2.5L

Catalog Number: BJBR663-4X2.5L
Supplier: Honeywell Research Chemicals
Product Image-10101-890

SUPV3L1 Antibody

Description: Polyclonal, Host: Rabbit, Species: Human, Immunogen: Produced in rabbits immunized with a synthetic peptide corresponding a region of human SUPV3L1. purified by peptide affinity chromatography method. Tested Applications: Elisa, Western blot
Catalog Number: 10101-890
Supplier: Prosci
Product Image-10106-968

GTF2H4 antibody

Description: Polyclonal antibody, Host:Rabbit, Species reactivity:Human, Mouse, Rat, Dog, Immunogen:Produced in rabbits immunized with a synthetic peptide corresponding a region of human GTF2H4. Purified by protein A chromatography method. Applications: ELISA, Western Blot, 100ug.
Catalog Number: 10106-968
Supplier: Prosci
3,217 - 3,232 of 119,188