Print…

You Searched For: Monarch+RNA+Cleanup+Kits


119,188  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"119188"

Rate These Search Results

Image Unavailable-76174-630

Staufen Picoband* Polyclonal Antibody 100ug/vial

Description: Staufen Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 532-568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN, Synonyms: Double-stranded RNA-binding protein Staufen homolog 1, STAU1, STAU, Size: 100ug/vial
Catalog Number: 76174-630
Supplier: Boster Biological Technology
Product Image-PAA6020

RT-qPCR System

Description: GoTaq* 1-Step RT-qPCR System for Dye-Based Detection, Performing precise, accurate 1-step RT-qPCR analysis, reagent system for quantitative analysis of RNA using a one-step reverse transcription-quantitative PCR (RT-qPCR) protocol in a single tube, size: 5ml
Catalog Number: PAA6020
Supplier: Promega Corporation

SDS Certificates


Image Unavailable-10088-600

Anti-IFIT5

Description: Anti-IFIT5 Antibody, Host Species: Rabbit, Cross Reactivity: Human, Immunogen: Recombinant Protein, C-term-350 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, Recommended Storage: - 20 C or lower
Catalog Number: 10088-600
Supplier: Proteintech
Product Image-95040-334

Ready-To-Go YouPrime1stStrand KitAbaxis

Catalog Number: 95040-334
Supplier: GE Healthcare - Life Sciences

SDS Certificates Product available on GSA Advantage®


Image Unavailable-10460-654

FTO Antibody

Description: FTO Polyclonal Antibody, Host: Rabbit , HRP Conjugated, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: Fat mass and obesity-associated protein; Fto, Application: IHC-P, 100ul
Catalog Number: 10460-654
Supplier: Bioss
Product Image-101227-238

RNA Cap Structure Analog [m7G(5')ppp(5')G]

Description: 125 A260 units.
Catalog Number: 101227-238
Supplier: New England Biolabs (NEB)

Small Business Enterprise


Product Image-101227-240

RNA Cap Structure Analog [m7G(5')ppp(5')G]

Description: 25 A260 units.
Catalog Number: 101227-240
Supplier: New England Biolabs (NEB)

Small Business Enterprise


Image Unavailable-PAG8321

The pFC30A His6HaloTag* T7 Flexi* Vector

Description: Is configured to append the His6HaloTag* tag to the carboxyterminus of the protein fusion partner and provides T7 RNA polymerase-driven protein expression in E. coli.
Catalog Number: PAG8321
Supplier: Promega Corporation
Image Unavailable-10391-352

FIBRILLARIN ANTIBODY

Catalog Number: 10391-352
Supplier: Bioss
Image Unavailable-102513-788

Aureothricin 1 mg

Catalog Number: 102513-788
Supplier: Adipogen

Small Business Enterprise


Product Image-101228-350

Antarctic Phosphatase (AnP)

Description: 1,000 units
Catalog Number: 101228-350
Supplier: New England Biolabs (NEB)

Certificates Small Business Enterprise


Product Image-101228-348

Antarctic Phosphatase (AnP)

Description: 5,000 units.
Catalog Number: 101228-348
Supplier: New England Biolabs (NEB)

Small Business Enterprise


Image Unavailable-10371-490

NIPP1/ARD1 Antibody

Description: NIPP1/ARD1 Polyclonal Antibody, Host: Rabbit, Cy3 Conjugated, Emmission: 512, 550nm/570, 615nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Activator of RNA decay; ARD 1; ARD1; Homolog of E.coli RNase E; NIPP 1, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10371-490
Supplier: Bioss
Product Image-10108-154

HNRPUL1 Antibody

Description: Polyclonal, Host: Rabbit; Species reactivity: Human, Dog; Immunogen: Produced in rabbits immunized with a synthetic peptide corresponding a region of human HNRPUL1; Purified by protein A chromatography method; Applications: Elisa, Western Blotting, IHC
Catalog Number: 10108-154
Supplier: Prosci
Image Unavailable-10472-014

MNAT1 Antibody

Description: MNAT1 Polyclonal Antibody, Host: Rabbit , Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: MAT1; TFB3; CAP35; RNF66, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10472-014
Supplier: Bioss
Image Unavailable-10472-028

MNAT1 Antibody

Description: MNAT1 Polyclonal Antibody, Host: Rabbit , Cy5 Conjugated, Emmission: 625,650nm/670nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: MAT1; TFB3; CAP35; RNF66, Application: IF(IHC-P), 100ul
Catalog Number: 10472-028
Supplier: Bioss
3,169 - 3,184 of 119,188