Print…

You Searched For: Molecular+Bioproducts+Inc.


377,326  results were found

Refine Results Sort by
SearchResultCount:"377326"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103013-620

Mouse Recombinant PD-1 (from HEK293 Cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: PD-1/PDCD1 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Mouse, Purity: >92% (SDS-PAGE), Molecular Characterization: Fc Chimera fused with a human IgG1 Fc tag at C-terminus, MW 43.2 KDa, Synonyms: PDCD1,PD1,CD279,SLEB2, Storage: 4 deg C, Size: 100ug

Product Image-76446-876

VWR® PCR Tubes and Caps

Supplier: VWR International
Description: Ideal for all PCR protocols, these 0.2 ml tubes and caps are made from polypropylene and are compatible with most popular thermal cycler blocks.

Image Unavailable-103010-688

Staphylococcus aureus Recombinant Protein A (from Bacteria)

Catalog Number: (103010-688)
Supplier: Anaspec Inc
Description: AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A is a non-glycosylated cell wall protein of Staphylococcus aureus that can bind the Fc part of immunoglobulin molecule of different species with strong affinity (1-4). Protein A consists of five IgG binding domains (A, B, C, D, and E), each approximately 60 amino acids long with no cysteines present and two S. aureus cell membrane binding domains, X and M (3).
Application: Recombinant Protein A can be used for immunoprecipitation, antibodies purification, and assay development.
Image Unavailable-103815-522

Human Recombinant Fc gamma RIIIB/ CD16b (NA1) (from HEK293 cells)

Catalog Number: (103815-522)
Supplier: ACROBIOSYSTEMS
Description: Human Fc gamma RIIIB / CD16b (NA1) Protein, His Tag (SPR & BLI verified), ACROBiosystems
Image Unavailable-103006-886

Hen Elafin

Catalog Number: (103006-886)
Supplier: Anaspec Inc
Description: This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.
Sequence:AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
MW:5999.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-75842-140

Anti-CD19 Rat Monoclonal Antibody (PE (Phycoerythrin)) [clone: 1D3]

Catalog Number: (75842-140)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The 1D3 monoclonal antibody specifically reacts with mouse CD19, a 95 kDa transmembrane glycoprotein, a member of the Ig superfamily and a B cell-lineage differentiation antigen expressed by all the B lymphocyte development stages, except for the terminally differentiated plasma cells. CD19 associates with CD21, CD81 and MHC class II to form a multi-molecular complex that initiates the mature B lymphocyte activation by interaction with the B-cell receptors. CD 19 enhances the B cell proliferation, development and activation, and the maturation of memory B cells. In CD19-deficient mice, the generation and maturation of B lymphocytes in the bone marrow and periphery are affected.
Image Unavailable-103014-582

Human Recombinant IL-1RL1 (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: IL-1RL1 / ST2 Protein, Fc Tag, Host: HEK293 Cells, Species Reactivity: Human, purity: >90%, Molecular Characterization: human IgG1 Fc tag at the C-terminus, MW of 61.6 kDa, Synonym: IL1RL1,DER4,FIT-1,IL33R,ST2,ST2L,ST2V,T1, Storage: 4 deg C, Size: 1MG

Image Unavailable-103013-658

Human Recombinant PD-L2 (from HEK293 Cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: PD-L2/B7-DC Protein, Mouse Fc Tag, Host: HEK293 cells, Species Reactivity: Human, Purity: >92% (SDS-PAGE), Molecular Characterization: Fc tag at C-terminus, MW 48.9 kD, Synonyms: PDL2,PD-L2,Butyrophilin B7-DC,CD273,PDCD1 ligand 2, Size: 1mg

Product Image-76446-860

VWR® PCR Strip Tubes & Caps 8-Strip

Supplier: VWR International
Description: Ideal for all PCR protocols, these 0.1 and 0.2 ml tubes and caps are made from polypropylene and are compatible with most popular thermal cycler blocks.

Image Unavailable-10780-484

Human Recombinant Apo-SAA (from E. coli)

Supplier: PeproTech, Inc.
Description: Human Apo-SAA is a 104 amino acid polypeptide that circulates primarily in association with high-density lipoproteins (HDL). The level of Apo-SAA, normally 1-5 μg/ml in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL apolipoprotein. The human SAA gene codes for a 122 amino acid polypeptide, which contains an 18 amino acid N-terminal signal sequence. Recombinant Apo-SAA is a consensus SAA molecule corresponding to human Apo-SAA1α, except for the presence of an N-terminal methionine, the substitution of asparagine for aspartic acid at position 60, and arginine for histidine at position 71 (the latter two substituted residues are present in Apo-SAA2β). The calculated molecular weight of Recombinant Human Apo-SAA is 11.7 kDa.

Image Unavailable-102999-364

[Lys0]-Bradykinin (Kallidin)

Catalog Number: (102999-364)
Supplier: Anaspec Inc
Description: [Lys0]-BK(1-10) is one of the two main Bradykinin peptides that act as a mediator of inflammation with evidence showing its release at high nanomolar concentrations into the tear-film of ocular allergic patients.
Sequence:KRPPGFSPFR
MW:1188.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103011-370

Tetramethylrhodamine methyl ester perchlorate (TMRM) mitochondria dye, suitable for fluorescence

Catalog Number: (103011-370)
Supplier: Anaspec Inc
Description: Used for measuring membrane potential of mitochondria; Fluorescence is less dependent on dye location.
Image Unavailable-103006-914

Histone H3 (1-25)

Catalog Number: (103006-914)
Supplier: Anaspec Inc
Description: This sequence corresponds to the N-terminus of histone H3, spanning amino acids 1 to 25, amidated. Histones are small proteins (11–22 kDa) that mediate the folding of DNA into chromatin.
Sequence:ARTKQTARKSTGGKAPRKQLATKAA-NH2
MW:2625.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-AGG1131A

Operating Supplies for 7900 and 8900 ICP-MS Systems

Supplier: AGILENT TECHNOLOGIES, INC (CSD)
Description: For these supplies, select required options to add interface cones and specific parts associated with extraction lens and ORS type.

New Product

Image Unavailable-102996-352

[Des-Arg10]-HOE I40

Catalog Number: (102996-352)
Supplier: Anaspec Inc
Description: A potent B1 bradykinin receptor antagonist. HOE 140 helps to discriminate the roles of Bradykinin receptors.
Sequence:rRP-Hyp-G-Thi-S-(D-Tic)-Oic
MW:1148.2 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103008-444

Gag Spacer Peptide P1

Catalog Number: (103008-444)
Supplier: Anaspec Inc
Description: This peptide sequence is derived from the Gag spacer peptide p1 that is encoded in the frameshift region of human immunodeficiency virus type 1 (HIV-1).
Sequence:HHHHHHIIKIIK
MW:1549.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,537 - 1,552 of 377,326
no targeter for Bottom