Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Image Unavailable-10781-294

Recombinant Human Pleiotrophin

Description: Recombinant Human Pleiotrophin is a 15.4 kDa protein containing 136 amino acid residues and five intra-molecular disulfide bonds, Animal free, Source: E.coli, Cross Reactivity: Bacteria, Mouse, Rat, Purity: > 98%, Synonyms: PTN, Heparin Affin Regulatory Protein, 1MG
Catalog Number: 10781-294
Supplier: PeproTech, Inc.
Image Unavailable-10781-284

Recombinant Human Pleiotrophin

Description: Recombinant Human Pleiotrophin is a 15.4 kDa protein containing 136 amino acid residues and five intra-molecular disulfide bonds, Animal free, Source: E.coli, Cross Reactivity: Bacteria, Mouse, Rat, Purity: > 98%, Synonyms: PTN, Heparin Affin Regulatory Protein, 20UG
Catalog Number: 10781-284
Supplier: PeproTech, Inc.
Image Unavailable-10781-286

Recombinant Human Pleiotrophin

Description: Recombinant Human Pleiotrophin is a 15.4 kDa protein containing 136 amino acid residues and five intra-molecular disulfide bonds, Animal free, Source: E.coli, Cross Reactivity: Bacteria, Mouse, Rat, Purity: > 98%, Synonyms: PTN, Heparin Affin Regulatory Protein, 50UG
Catalog Number: 10781-286
Supplier: PeproTech, Inc.
Image Unavailable-103010-874

HiLyte* Fluor 488 acid, SE 5 mg

Description: HiLyte* Fluor 488 acid, SE, amine-reactive fluorescent labeling dye, Synonym: HiLyte* Fluor 488 acid, NHS ester, Molecular Weight: 698.6, Spectral Properties: Abs/Em = 502/527 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103010-874
Supplier: Anaspec Inc
Image Unavailable-103010-876

HiLyte* Fluor 488 acid, SE 1 mg

Description: HiLyte* Fluor 488 acid, SE, amine-reactive fluorescent labeling dye, Synonym: HiLyte* Fluor 488 acid, NHS ester, Molecular Weight: 698.6, Spectral Properties: Abs/Em = 502/527 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103010-876
Supplier: Anaspec Inc
Product Image-10500-044

Column

Description: GC column, GSBP-PLOT MS, Molecular Sieves, 5A, immobilized Temperature -80 to 300C.Equivalent to HP-PLOT/Molesieve, CP-Molesieve PLOT, Typical Applications: H2, Ar, O2, N2, CH4, CO, landfill gas, globe warming, noble gases, SF6, N2O, MSx5Ax30M0.53MM50.0UM
Catalog Number: 10500-044
Supplier: General Separation Technologies, Inc.
Product Image-10500-032

Column

Description: GC column, GSBP-PLOT MS, Molecular Sieves, 5A, immobilized Temperature -80 to 300C.Equivalent to HP-PLOT/Molesieve, CP-Molesieve PLOT, Typical Applications: H2, Ar, O2, N2, CH4, CO, landfill gas, globe warming, noble gases, SF6, N2O, MSx5Ax15M0.32MM12.0UM
Catalog Number: 10500-032
Supplier: General Separation Technologies, Inc.
Product Image-10500-034

Column

Description: GC column, GSBP-PLOT MS, Molecular Sieves, 5A, immobilized Temperature -80 to 300C.Equivalent to HP-PLOT/Molesieve, CP-Molesieve PLOT, Typical Applications: H2, Ar, O2, N2, CH4, CO, landfill gas, globe warming, noble gases, SF6, N2O, MSx5Ax30M0.32MM12.0UM
Catalog Number: 10500-034
Supplier: General Separation Technologies, Inc.
Product Image-10500-042

Column

Description: GC column, GSBP-PLOT MS, Molecular Sieves, 5A, immobilized Temperature -80 to 300C.Equivalent to HP-PLOT/Molesieve, CP-Molesieve PLOT, Typical Applications: H2, Ar, O2, N2, CH4, CO, landfill gas, globe warming, noble gases, SF6, N2O, MSx5Ax30M0.53MM25.0UM
Catalog Number: 10500-042
Supplier: General Separation Technologies, Inc.
Product Image-10500-040

Column

Description: GC column, GSBP-PLOT MS, Molecular Sieves, 5A, immobilized Temperature -80 to 300C.Equivalent to HP-PLOT/Molesieve, CP-Molesieve PLOT, Typical Applications: H2, Ar, O2, N2, CH4, CO, landfill gas, globe warming, noble gases, SF6, N2O, MSx5Ax15M0.53MM50.0UM
Catalog Number: 10500-040
Supplier: General Separation Technologies, Inc.
Image Unavailable-10779-428

Recombinant Human Vitronectin

Description: Recombinant Human Vitronectin, 459 AA, single-chain, monomeric protein, which migrates at an apparent 52.2 kDa, secreted glycoprotein, Source: HEK293 cells, >95%, Synonyms: VTN, Serum-spreading factor, V75, 500UG
Catalog Number: 10779-428
Supplier: PeproTech, Inc.
Image Unavailable-10779-426

Recombinant Human Vitronectin

Description: Recombinant Human Vitronectin, 459 AA, single-chain, monomeric protein, which migrates at an apparent 52.2 kDa, secreted glycoprotein, Source: HEK293 cells, >95%, Synonyms: VTN, Serum-spreading factor, V75, 100UG
Catalog Number: 10779-426
Supplier: PeproTech, Inc.
Image Unavailable-103888-432

Human Integrin alpha L beta 2 (ITGAL&ITGB2) Heterodimer Protein, His Tag&Tag Free, Source: expressed from HEK293. It contains AA Tyr 26 - Met 1089 (ITGAL) & Gln 23 - Asn 700 (ITGB2), Molecular weight: 124.2 kDa (ITGAL) & 80.1 kDa (ITGB2), Synonyms: Integrin alpha L beta 2, Size: 100uG

Description: Human Integrin alpha L beta 2 (ITGAL&ITGB2) Heterodimer Protein, His Tag&Tag Free, Source: expressed from HEK293. It contains AA Tyr 26 - Met 1089 (ITGAL) & Gln 23 - Asn 700 (ITGB2), Molecular weight: 124.2 kDa (ITGAL) & 80.1 kDa (ITGB2), Synonyms: Integrin alpha L beta 2, Size: 100uG
Catalog Number: 103888-432
Supplier: ACROBIOSYSTEMS
Image Unavailable-102996-482

Beta-Amyloid (12-28), Human1 mg

Description: Beta-Amyloid (12-28), Human, Purity: HPLC >/= 95%, Molecular Weight: 1955.2, Sequence: H-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH, Appearance: Lyophilized white powder, residues are the binding site for apolipoprotein E, Size: 1mg
Catalog Number: 102996-482
Supplier: Anaspec Inc
Image Unavailable-103007-366

[Met(O)35] - beta - Amyloid (1 - 42) 0.5 mg

Description: [Met(O)35] - beta - Amyloid (1 - 42), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL - M(O) - VGGVVIA, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4530.1, Apperance: Powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-366
Supplier: Anaspec Inc
Image Unavailable-103007-714

3 x Hemagglutinin (HA) Tag 1 mg

Description: 3 x Hemagglutinin (HA) Tag, Sequence: MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE, Purity: By HPLC greater than or equal to 95%, tag peptide may be used to detect proteins and peptides, Molecular Weight: 4372.7, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-714
Supplier: Anaspec Inc
1,425 - 1,440 of 485,990