Print…

You Searched For: Molecular+Bioproducts+Inc.


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Image Unavailable-102996-316

VIP 1 mg

Description: VIP, human, porcine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 3325.9, Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, Appearance: Lyophilized white powder, is a neurotransmitter and a neuromodulator, broadly distributed in the peripheral and central nervous systems, Size: 1 mg
Catalog Number: 102996-316
Supplier: Anaspec Inc
Image Unavailable-103007-868

(Leu15)-Gastrin-1 human 1 mg

Description: (Leu15)-Gastrin-1, human, Sequence: Pyr-GPWLEEEEEAYGWLDF-NH2, Purity: By HPLC >/= 95%, This human Gastrin-1 analog is functionally the same as the native sequence, this analog is more stable, Molecular Weight: 2080.2, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-868
Supplier: Anaspec Inc
Image Unavailable-102996-314

VIP 0.5 mg

Description: VIP, human, porcine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 3325.9, Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, Appearance: Lyophilized white powder, is a neurotransmitter and a neuromodulator, broadly distributed in the peripheral and central nervous systems, Size: 0.5 mg
Catalog Number: 102996-314
Supplier: Anaspec Inc
Image Unavailable-103006-230

Trp63 64]-C3a (63-77) 1 mg

Description: Trp63, 64]-C3a (63-77), C-terminal analogue of the complement factor C3a, acts as an agonist to the C3a receptor, Purity: HPLC >/=95%, Sequence (One-Letter Code): WWGKKYRASKLGLAR, Molecular weight: 1820.2, Appearance: Off-White solid, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-230
Supplier: Anaspec Inc
Image Unavailable-103013-030

Biotinylated Human FcRn/FCGRT & B2M Avitag* 200ug

Description: FcRn/FCGRT & B2M, Biotinylated, Host: HEK293 Cells, Species: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: carries an Avitag* at the C-terminus, Molecular weight 33 kDa, Synonym: FcRn, FCGRT & B2M, Size: 200ug
Catalog Number: 103013-030
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-464

Cynomolgus beta 2-Microglobulin/B2M Protein 100ug

Description: Beta 2-Microglobulin/B2M Protein, Host: HEK293 Cells, Species reactivity: Cynomolgus, Purity: >95%by SDS-PAGE, Molecular Characterization: Fused with a polyhistidine tag at the C-terminus, Molecular weight of 12.6 kDa, Synonym: B2M, Size: 100ug
Catalog Number: 103013-464
Supplier: ACROBIOSYSTEMS
Image Unavailable-103007-272

Bim BH3, Peptide IV 1 mg

Description: Bim BH3, Peptide IV, Sequence: DMRPEIWIAQELRRIGDEFNAYYARR, Bim peptide belongs to the pro-apoptotic group of the Bcl-2 family of proteins, Molecular Weight: 3269.7, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-272
Supplier: Anaspec Inc
Image Unavailable-103008-028

Histone H3 (23-34) 1 mg

Description: Histone H3 (23-34), Sequence: KAARKSAPATGG, Purity: By HPLC greater than or equal to 95%, This peptide is Histone H3 amino acid residues 23 to 34, Molecular Weight: 1114.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103008-028
Supplier: Anaspec Inc
Product Image-10128-494

Potassium Chloride 1M 500ml, DNase and RNase tested. Store at: 15-30 degree C

Catalog Number: 10128-494
Supplier: QUALITY BIOLOGICAL, INC.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-103013-202

Mouse GPA33/A33 Protein 50ug

Description: GPA33/A33 Protein, Host: HEK293 Cells, Species reactivity: Mouse, Purity: >95% as determined by SDS-PAGE, Molecular Characterization: His Tag is Fused with a polyhistidine tag at the C-terminus, Molecular weight of 24.7 kDa, Synonym: GPA33, A33, Size: 50ug
Catalog Number: 103013-202
Supplier: ACROBIOSYSTEMS
Image Unavailable-103010-874

HiLyte* Fluor 488 acid, SE 5 mg

Description: HiLyte* Fluor 488 acid, SE, amine-reactive fluorescent labeling dye, Synonym: HiLyte* Fluor 488 acid, NHS ester, Molecular Weight: 698.6, Spectral Properties: Abs/Em = 502/527 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103010-874
Supplier: Anaspec Inc
Image Unavailable-103010-876

HiLyte* Fluor 488 acid, SE 1 mg

Description: HiLyte* Fluor 488 acid, SE, amine-reactive fluorescent labeling dye, Synonym: HiLyte* Fluor 488 acid, NHS ester, Molecular Weight: 698.6, Spectral Properties: Abs/Em = 502/527 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103010-876
Supplier: Anaspec Inc
Image Unavailable-103815-336

Glypican 2 Protein, His Tag, Species Reactivity: Mouse, Host: HEK293, Purity: >90% as determined by SDS-PAGE, Molecular Weight: 60.6 kDa, Molecular Characterization: protein carries a polyhistidine tag at the C-terminus, Synonym: Glypican 2, Size: 100ug

Description: Glypican 2 Protein, His Tag, Species Reactivity: Mouse, Host: HEK293, Purity: >90% as determined by SDS-PAGE, Molecular Weight: 60.6 kDa, Molecular Characterization: protein carries a polyhistidine tag at the C-terminus, Synonym: Glypican 2, Size: 100ug
Catalog Number: 103815-336
Supplier: ACROBIOSYSTEMS
Image Unavailable-103815-334

Glypican 2 Protein, His Tag, Species Reactivity: Mouse, Host: HEK293, Purity: >90% as determined by SDS-PAGE, Molecular Weight: 60.6 kDa, Molecular Characterization: protein carries a polyhistidine tag at the C-terminus, Synonym: Glypican 2, Size: 1mg

Description: Glypican 2 Protein, His Tag, Species Reactivity: Mouse, Host: HEK293, Purity: >90% as determined by SDS-PAGE, Molecular Weight: 60.6 kDa, Molecular Characterization: protein carries a polyhistidine tag at the C-terminus, Synonym: Glypican 2, Size: 1mg
Catalog Number: 103815-334
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-750

Recom Properdin human >90% 50.7 kDa 1mg

Description: Properdin Protein, His Tag, Recombinant, Source: HEK293, Species: human,Purity: >90% as determined by SDS-PAGE, Molecular weight: 50.7 kDa, Synonyms: Properdin, Complement factor P, CFP, PFC, Size: 1mg
Catalog Number: 103790-750
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-748

Recom Properdin hu >90% 50.7 kDa 100UG

Description: Properdin Protein, His Tag, Recombinant, Source: HEK293, Species: human,Purity: >90% as determined by SDS-PAGE, Molecular weight: 50.7 kDa, Synonyms: Properdin, Complement factor P, CFP, PFC, Size: 100UG
Catalog Number: 103790-748
Supplier: ACROBIOSYSTEMS
1,393 - 1,408 of 485,990